BLASTX nr result
ID: Gardenia21_contig00027942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027942 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007922582.1| hypothetical protein MYCFIDRAFT_53414 [Pseud... 57 4e-06 >ref|XP_007922582.1| hypothetical protein MYCFIDRAFT_53414 [Pseudocercospora fijiensis CIRAD86] gi|452985617|gb|EME85373.1| hypothetical protein MYCFIDRAFT_53414 [Pseudocercospora fijiensis CIRAD86] Length = 212 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/108 (33%), Positives = 53/108 (49%) Frame = -1 Query: 325 DFMEASTASEAKLTGSSSSRSEAKKDFKQTTERAEKKFEEVKGRAIDEYENNVKPNVKAS 146 DFM + AS +L + K + K ++++EKK+E+VKG+A +E++ K KA Sbjct: 86 DFMHRAEASAKQLG------KDFKSESKTFSQKSEKKYEQVKGKAKEEWQQAKKDGKKAE 139 Query: 145 VXXXXXXXXXXXQWADKNKGHPXXXXXXXXXXXLSGFLGIGAYRMHKA 2 WA+KNK +P L LG GAYRMHK+ Sbjct: 140 ------------DWAEKNKNNPVVVGNAVVIAALGALLGTGAYRMHKS 175