BLASTX nr result
ID: Gardenia21_contig00027721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027721 (519 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19333.1| unnamed protein product [Coffea canephora] 97 5e-18 >emb|CDP19333.1| unnamed protein product [Coffea canephora] Length = 147 Score = 97.1 bits (240), Expect = 5e-18 Identities = 46/54 (85%), Positives = 47/54 (87%) Frame = -1 Query: 519 GTVPNPEESPFSIFSIAMIFHSFGFPRITSLTDLLFMRDSYCHNRLYFTAFCQT 358 G+VPNPE PFSIFSIAMIF SFGFPRIT LTDLLFM DSYCH RLYF AFCQT Sbjct: 94 GSVPNPEARPFSIFSIAMIFPSFGFPRITFLTDLLFMGDSYCHYRLYFFAFCQT 147