BLASTX nr result
ID: Gardenia21_contig00027695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027695 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13242.1| unnamed protein product [Coffea canephora] 77 7e-12 >emb|CDP13242.1| unnamed protein product [Coffea canephora] Length = 285 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 319 DRSLTEFPPLVGSTDGVSVNGTYNEAQFMQESHQVGNEVEGPT 191 DRSLTEFPPLVGSTDG SV G Y EAQ+MQES Q GNEVEGPT Sbjct: 243 DRSLTEFPPLVGSTDGFSVYGNYKEAQYMQESRQAGNEVEGPT 285