BLASTX nr result
ID: Gardenia21_contig00027542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027542 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04672.1| unnamed protein product [Coffea canephora] 78 3e-12 >emb|CDP04672.1| unnamed protein product [Coffea canephora] Length = 198 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -3 Query: 141 MQNLKPKLGSLGIMFHQSSRISSLSHHQESQSGLIKNPDAGSRNRPT 1 M NLKPKLGSLG+MFHQSS I+S HHQESQSGLIKN AGS NRPT Sbjct: 1 MHNLKPKLGSLGVMFHQSSGIASFYHHQESQSGLIKNLGAGSCNRPT 47