BLASTX nr result
ID: Gardenia21_contig00027458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027458 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO96905.1| unnamed protein product [Coffea canephora] 127 4e-27 ref|XP_006346725.1| PREDICTED: monothiol glutaredoxin-S2-like [S... 96 1e-17 ref|XP_004236718.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 96 1e-17 ref|XP_004236714.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 95 2e-17 ref|XP_009779582.1| PREDICTED: monothiol glutaredoxin-S1-like [N... 94 3e-17 ref|XP_004236719.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 94 3e-17 ref|XP_006346726.1| PREDICTED: monothiol glutaredoxin-S2-like [S... 94 5e-17 ref|XP_006346723.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 94 5e-17 ref|XP_004236721.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 94 5e-17 ref|XP_004236716.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 94 5e-17 ref|XP_004236717.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 93 7e-17 ref|XP_004236715.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 93 7e-17 ref|XP_009591194.1| PREDICTED: monothiol glutaredoxin-S1-like [N... 93 9e-17 ref|XP_004236720.1| PREDICTED: monothiol glutaredoxin-S1-like [S... 93 9e-17 ref|XP_009781310.1| PREDICTED: monothiol glutaredoxin-S6-like [N... 92 1e-16 emb|CDP12907.1| unnamed protein product [Coffea canephora] 92 1e-16 ref|XP_009603211.1| PREDICTED: monothiol glutaredoxin-S6-like [N... 92 2e-16 emb|CDP12908.1| unnamed protein product [Coffea canephora] 92 2e-16 emb|CDP12904.1| unnamed protein product [Coffea canephora] 92 2e-16 ref|XP_009757078.1| PREDICTED: monothiol glutaredoxin-S1-like [N... 91 3e-16 >emb|CDO96905.1| unnamed protein product [Coffea canephora] Length = 102 Score = 127 bits (318), Expect = 4e-27 Identities = 62/68 (91%), Positives = 65/68 (95%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANPKVYEID+H DG+KM RELLRLGQ+ SVPTVFIGKEMIGGSDEVIGLNVKGELKPLL Sbjct: 35 GANPKVYEIDQHQDGQKMERELLRLGQEPSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 94 Query: 183 IRAKAIWI 206 IRAKAIWI Sbjct: 95 IRAKAIWI 102 >ref|XP_006346725.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum tuberosum] Length = 102 Score = 95.9 bits (237), Expect = 1e-17 Identities = 41/68 (60%), Positives = 58/68 (85%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP+G++M R L+ LG + SVP +FIGKE++GG++E++ LN++G+LK LL Sbjct: 35 GANPIVYELDTHPNGKQMERALMELGCEPSVPAIFIGKELVGGANEIMSLNLRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRAKAIW+ Sbjct: 95 IRAKAIWV 102 >ref|XP_004236718.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 95.9 bits (237), Expect = 1e-17 Identities = 41/68 (60%), Positives = 57/68 (83%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP+G++M + L+ LG SVPT+FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPTVYELDTHPNGKQMEKALMELGCQPSVPTIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_004236714.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/68 (61%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP+G+KM + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPIVYELDTHPNGKKMEKALMELGCHPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIWI Sbjct: 95 IRANAIWI 102 >ref|XP_009779582.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana sylvestris] Length = 102 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/68 (63%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VY+IDE P+G+K+ R LL +G+ S PT FIGKE++GGS+EVI LN++G+LK LL Sbjct: 35 GANPTVYKIDELPNGKKVERALLEMGRKPSTPTTFIGKELVGGSNEVISLNIRGKLKDLL 94 Query: 183 IRAKAIWI 206 I+A AIWI Sbjct: 95 IKANAIWI 102 >ref|XP_004236719.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 94.4 bits (233), Expect = 3e-17 Identities = 40/68 (58%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G+KM + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPIIYELDTHPNGKKMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_006346726.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum tuberosum] Length = 102 Score = 93.6 bits (231), Expect = 5e-17 Identities = 40/68 (58%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPAVYELDTHPNGKQMEKALMELGCHPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_006346723.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum tuberosum] Length = 102 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/68 (57%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPTIYELDTHPNGKQMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_004236721.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 93.6 bits (231), Expect = 5e-17 Identities = 40/68 (58%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPTVYELDTHPNGKQMEKALMELGCHPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_004236716.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/68 (57%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPTIYELDTHPNGKQMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_004236717.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 93.2 bits (230), Expect = 7e-17 Identities = 38/68 (55%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LN++G+LK LL Sbjct: 35 GANPTIYELDTHPNGKQMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNIRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_004236715.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 93.2 bits (230), Expect = 7e-17 Identities = 40/68 (58%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPIIYELDTHPNGKQMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIWI Sbjct: 95 IRANAIWI 102 >ref|XP_009591194.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana tomentosiformis] Length = 102 Score = 92.8 bits (229), Expect = 9e-17 Identities = 43/68 (63%), Positives = 55/68 (80%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VY+IDE P+G+K+ R LL +G S PT FIGKE++GGS+EVI LN++G+LK LL Sbjct: 35 GANPTVYKIDELPNGKKVERALLEMGCKPSTPTTFIGKELVGGSNEVISLNIRGKLKDLL 94 Query: 183 IRAKAIWI 206 I+A AIWI Sbjct: 95 IKANAIWI 102 >ref|XP_004236720.1| PREDICTED: monothiol glutaredoxin-S1-like [Solanum lycopersicum] Length = 102 Score = 92.8 bits (229), Expect = 9e-17 Identities = 39/68 (57%), Positives = 56/68 (82%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP +YE+D HP+G++M + L+ LG SVP +FIGKE++GG++E++ LNV+G+LK LL Sbjct: 35 GANPIIYELDTHPNGKQMEKALMELGCQPSVPAIFIGKELVGGANEIMSLNVRGKLKQLL 94 Query: 183 IRAKAIWI 206 IRA AIW+ Sbjct: 95 IRANAIWV 102 >ref|XP_009781310.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana sylvestris] Length = 102 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VY++DE P G+KM + L+ +G + S P +FIGKE +GGSDEV+ LNVKG+LK LL Sbjct: 35 GANPTVYKLDELPKGKKMEKALIEMGCNPSTPAIFIGKEFVGGSDEVMSLNVKGKLKDLL 94 Query: 183 IRAKAIWI 206 I+A AIWI Sbjct: 95 IKANAIWI 102 >emb|CDP12907.1| unnamed protein product [Coffea canephora] Length = 102 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D+HP G+++ LL LG SVP VFIGK +GGSDEV+ LNV+G+LKPLL Sbjct: 35 GANPTVYELDQHPKGQEIENALLALGCHPSVPAVFIGKLFVGGSDEVMSLNVQGKLKPLL 94 Query: 183 IRAKAIWI 206 I+A AIW+ Sbjct: 95 IKANAIWM 102 >ref|XP_009603211.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana tomentosiformis] Length = 102 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/68 (61%), Positives = 53/68 (77%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VY++DE P G+KM + L+ +G + S P +FIGKE +GGSDEV+ LNVKG+LK LL Sbjct: 35 GANPTVYKLDELPKGKKMEKALIEMGCNPSTPAIFIGKEFVGGSDEVMSLNVKGKLKELL 94 Query: 183 IRAKAIWI 206 I A AIWI Sbjct: 95 INANAIWI 102 >emb|CDP12908.1| unnamed protein product [Coffea canephora] Length = 102 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/68 (63%), Positives = 53/68 (77%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D HP GR++ LL LG + SVP VFIGK +GGS+EV+ LNV+G+LKPLL Sbjct: 35 GANPTVYELDHHPKGREIENALLTLGCNPSVPAVFIGKLFVGGSNEVMSLNVRGKLKPLL 94 Query: 183 IRAKAIWI 206 I A AIW+ Sbjct: 95 IEANAIWM 102 >emb|CDP12904.1| unnamed protein product [Coffea canephora] Length = 102 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D++P+GR + LL LG +VP VFIGK ++GGSDEV+ LNV+G+LKPLL Sbjct: 35 GANPTVYELDQYPEGRDIENALLALGCHPTVPAVFIGKLLVGGSDEVMNLNVQGKLKPLL 94 Query: 183 IRAKAIWI 206 I+A AIW+ Sbjct: 95 IKANAIWM 102 >ref|XP_009757078.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana sylvestris] Length = 102 Score = 91.3 bits (225), Expect = 3e-16 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = +3 Query: 3 GANPKVYEIDEHPDGRKMVRELLRLGQDSSVPTVFIGKEMIGGSDEVIGLNVKGELKPLL 182 GANP VYE+D+ P+GR+M L+ LG SVP VFIGK+ +GGS+E++ LNV+GELK LL Sbjct: 35 GANPTVYELDKLPNGRQMENALIELGCQLSVPAVFIGKDFVGGSNEIMSLNVRGELKQLL 94 Query: 183 IRAKAIWI 206 +RA AIWI Sbjct: 95 LRANAIWI 102