BLASTX nr result
ID: Gardenia21_contig00027413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027413 (841 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98371.1| unnamed protein product [Coffea canephora] 115 5e-23 ref|XP_009769078.1| PREDICTED: pentatricopeptide repeat-containi... 104 9e-20 ref|XP_009601536.1| PREDICTED: pentatricopeptide repeat-containi... 104 9e-20 ref|XP_003609218.2| pentatricopeptide (PPR) repeat protein, part... 103 2e-19 ref|XP_004236423.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-19 gb|KOM43397.1| hypothetical protein LR48_Vigan05g100100 [Vigna a... 102 3e-19 ref|XP_014506793.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-19 ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfam... 102 5e-19 ref|XP_010275265.1| PREDICTED: pentatricopeptide repeat-containi... 101 6e-19 gb|KDO62894.1| hypothetical protein CISIN_1g004024mg [Citrus sin... 101 6e-19 ref|XP_006490750.1| PREDICTED: pentatricopeptide repeat-containi... 101 6e-19 ref|XP_006451657.1| hypothetical protein CICLE_v10007619mg [Citr... 101 6e-19 gb|KNA09489.1| hypothetical protein SOVF_153080 [Spinacia oleracea] 100 1e-18 ref|XP_012440315.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-18 emb|CBI15551.3| unnamed protein product [Vitis vinifera] 100 1e-18 ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-18 ref|XP_009356059.1| PREDICTED: pentatricopeptide repeat-containi... 100 1e-18 ref|XP_006341567.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-18 ref|XP_007160512.1| hypothetical protein PHAVU_002G328100g [Phas... 100 2e-18 ref|XP_007160511.1| hypothetical protein PHAVU_002G328000g [Phas... 100 2e-18 >emb|CDO98371.1| unnamed protein product [Coffea canephora] Length = 777 Score = 115 bits (287), Expect = 5e-23 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW Sbjct: 727 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 777 >ref|XP_009769078.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nicotiana sylvestris] gi|698550736|ref|XP_009769079.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nicotiana sylvestris] Length = 774 Score = 104 bits (259), Expect = 9e-20 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVC DCHTAIK ISKIVGRLII+RD+NRFHHF GGVCTCGDYW Sbjct: 724 PIRVMKNLRVCGDCHTAIKIISKIVGRLIIIRDNNRFHHFSGGVCTCGDYW 774 >ref|XP_009601536.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nicotiana tomentosiformis] Length = 800 Score = 104 bits (259), Expect = 9e-20 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVC DCHTAIK ISKIVGRLII+RD+NRFHHF GGVCTCGDYW Sbjct: 750 PIRVMKNLRVCGDCHTAIKIISKIVGRLIIIRDNNRFHHFSGGVCTCGDYW 800 >ref|XP_003609218.2| pentatricopeptide (PPR) repeat protein, partial [Medicago truncatula] gi|657390605|gb|AES91415.2| pentatricopeptide (PPR) repeat protein, partial [Medicago truncatula] Length = 1017 Score = 103 bits (256), Expect = 2e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIR++KNLRVC DCHTA KYISKIVGR II+RDSNRFHHFGGG+C+CGDYW Sbjct: 967 PIRIMKNLRVCGDCHTAFKYISKIVGRQIILRDSNRFHHFGGGMCSCGDYW 1017 >ref|XP_004236423.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum lycopersicum] Length = 765 Score = 102 bits (255), Expect = 3e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVC DCHTAIK ISKIVGRLIIVRDSNRFHHF GVCTCGDYW Sbjct: 715 PIRVMKNLRVCGDCHTAIKLISKIVGRLIIVRDSNRFHHFSEGVCTCGDYW 765 >gb|KOM43397.1| hypothetical protein LR48_Vigan05g100100 [Vigna angularis] Length = 774 Score = 102 bits (254), Expect = 3e-19 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVC+DCH AIK+ISKIVGRLII+RDSNRFHHF GVC+CGDYW Sbjct: 724 PIRVIKNLRVCQDCHNAIKHISKIVGRLIILRDSNRFHHFNDGVCSCGDYW 774 >ref|XP_014506793.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vigna radiata var. radiata] Length = 774 Score = 102 bits (253), Expect = 5e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVC+DCH AIK+ISKIVGRLII+RDSNRFHHF G+C+CGDYW Sbjct: 724 PIRVIKNLRVCQDCHNAIKHISKIVGRLIILRDSNRFHHFNDGICSCGDYW 774 >ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590665507|ref|XP_007036763.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590665511|ref|XP_007036764.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774007|gb|EOY21263.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774008|gb|EOY21264.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774009|gb|EOY21265.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 768 Score = 102 bits (253), Expect = 5e-19 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVCEDCH AIKYISKIVGRLII+RDSNRFHHF G C+CGDYW Sbjct: 718 PIRVIKNLRVCEDCHNAIKYISKIVGRLIILRDSNRFHHFREGSCSCGDYW 768 >ref|XP_010275265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nelumbo nucifera] gi|720061733|ref|XP_010275266.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nelumbo nucifera] Length = 772 Score = 101 bits (252), Expect = 6e-19 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVCEDCH +KYISK++GRLII+RDSNRFHHF GG+C+CGDYW Sbjct: 722 PIRVIKNLRVCEDCHIFVKYISKLMGRLIILRDSNRFHHFDGGLCSCGDYW 772 >gb|KDO62894.1| hypothetical protein CISIN_1g004024mg [Citrus sinensis] Length = 778 Score = 101 bits (252), Expect = 6e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVCEDCH AIK+ISKIVGRLII+RD+NRFHHF GG C+CGDYW Sbjct: 728 PIRVMKNLRVCEDCHNAIKHISKIVGRLIILRDNNRFHHFSGGSCSCGDYW 778 >ref|XP_006490750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Citrus sinensis] Length = 778 Score = 101 bits (252), Expect = 6e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVCEDCH AIK+ISKIVGRLII+RD+NRFHHF GG C+CGDYW Sbjct: 728 PIRVMKNLRVCEDCHNAIKHISKIVGRLIILRDNNRFHHFSGGSCSCGDYW 778 >ref|XP_006451657.1| hypothetical protein CICLE_v10007619mg [Citrus clementina] gi|557554883|gb|ESR64897.1| hypothetical protein CICLE_v10007619mg [Citrus clementina] Length = 707 Score = 101 bits (252), Expect = 6e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVCEDCH AIK+ISKIVGRLII+RD+NRFHHF GG C+CGDYW Sbjct: 657 PIRVMKNLRVCEDCHNAIKHISKIVGRLIILRDNNRFHHFSGGSCSCGDYW 707 >gb|KNA09489.1| hypothetical protein SOVF_153080 [Spinacia oleracea] Length = 707 Score = 100 bits (250), Expect = 1e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLR+CEDCHTAIK+ISK+ GRLIIVRDSNRFHHF GVC+CGDYW Sbjct: 657 PIRVMKNLRICEDCHTAIKHISKLEGRLIIVRDSNRFHHFKQGVCSCGDYW 707 >ref|XP_012440315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Gossypium raimondii] gi|763785953|gb|KJB53024.1| hypothetical protein B456_008G289000 [Gossypium raimondii] Length = 769 Score = 100 bits (250), Expect = 1e-18 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVCEDCH AIKYISKIVGRLII+RDSNRFHHF G C+CGDYW Sbjct: 719 PIRVMKNLRVCEDCHNAIKYISKIVGRLIILRDSNRFHHFREGSCSCGDYW 769 >emb|CBI15551.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 100 bits (250), Expect = 1e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVCEDCH A+K+ISKIVGRLII+RDS+RFHHF GG C+CGDYW Sbjct: 635 PIRVIKNLRVCEDCHNAMKHISKIVGRLIILRDSHRFHHFNGGQCSCGDYW 685 >ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Vitis vinifera] Length = 766 Score = 100 bits (250), Expect = 1e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRVIKNLRVCEDCH A+K+ISKIVGRLII+RDS+RFHHF GG C+CGDYW Sbjct: 716 PIRVIKNLRVCEDCHNAMKHISKIVGRLIILRDSHRFHHFNGGQCSCGDYW 766 >ref|XP_009356059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Pyrus x bretschneideri] Length = 784 Score = 100 bits (249), Expect = 1e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 P+RVIKNLRVCEDCH AIKYISKIVGR II+RDS+RFHHF GG C+CGDYW Sbjct: 734 PVRVIKNLRVCEDCHNAIKYISKIVGRTIILRDSHRFHHFTGGNCSCGDYW 784 >ref|XP_006341567.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 765 Score = 100 bits (248), Expect = 2e-18 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -3 Query: 836 IRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 IRV+KNLRVC DCHTAIK ISKIVGRLIIVRDSNRFHHF GVCTCGDYW Sbjct: 716 IRVMKNLRVCGDCHTAIKLISKIVGRLIIVRDSNRFHHFSEGVCTCGDYW 765 >ref|XP_007160512.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] gi|561033927|gb|ESW32506.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] Length = 783 Score = 99.8 bits (247), Expect = 2e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVC+DCH AI++ISKIVGRLII+RDSNRFHHF G+C+CGDYW Sbjct: 733 PIRVMKNLRVCQDCHNAIRHISKIVGRLIILRDSNRFHHFNDGICSCGDYW 783 >ref|XP_007160511.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris] gi|561033926|gb|ESW32505.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris] Length = 691 Score = 99.8 bits (247), Expect = 2e-18 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 839 PIRVIKNLRVCEDCHTAIKYISKIVGRLIIVRDSNRFHHFGGGVCTCGDYW 687 PIRV+KNLRVCEDCH AIK+ISKIVGRLII+RDS+RFHHF G+C+CGDYW Sbjct: 641 PIRVMKNLRVCEDCHNAIKHISKIVGRLIILRDSHRFHHFSEGICSCGDYW 691