BLASTX nr result
ID: Gardenia21_contig00027343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027343 (246 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18259.1| unnamed protein product [Coffea canephora] 112 8e-23 >emb|CDP18259.1| unnamed protein product [Coffea canephora] Length = 723 Score = 112 bits (281), Expect = 8e-23 Identities = 58/71 (81%), Positives = 59/71 (83%), Gaps = 1/71 (1%) Frame = +2 Query: 35 QLRTIPPKSYRTPRKATNNSSSMVACLPHRMALSLY-SLNPLLTPSLRFFSNPFPVFSCS 211 QLR PPKSYRTPRKATN SSMVA LPHRMA SLY SLNPLLTPSLR SNP PVFS S Sbjct: 14 QLRATPPKSYRTPRKATNKPSSMVASLPHRMASSLYSSLNPLLTPSLRLLSNPLPVFSSS 73 Query: 212 IPRSTETVVKF 244 IPRSTETV+ F Sbjct: 74 IPRSTETVINF 84