BLASTX nr result
ID: Gardenia21_contig00027205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027205 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98062.1| unnamed protein product [Coffea canephora] 69 2e-09 ref|XP_011072337.1| PREDICTED: regulator of telomere elongation ... 66 9e-09 ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 65 2e-08 ref|XP_010318571.1| PREDICTED: regulator of telomere elongation ... 65 3e-08 ref|XP_010318570.1| PREDICTED: regulator of telomere elongation ... 65 3e-08 ref|XP_010318569.1| PREDICTED: regulator of telomere elongation ... 65 3e-08 ref|XP_010318568.1| PREDICTED: regulator of telomere elongation ... 65 3e-08 ref|XP_010318567.1| PREDICTED: regulator of telomere elongation ... 65 3e-08 ref|XP_012450204.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450203.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450202.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450200.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450198.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450197.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012450196.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 ref|XP_012073335.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 gb|KJB68147.1| hypothetical protein B456_010G228200 [Gossypium r... 64 3e-08 ref|XP_012450199.1| PREDICTED: regulator of telomere elongation ... 64 3e-08 gb|KJB68145.1| hypothetical protein B456_010G228200 [Gossypium r... 64 3e-08 gb|KJB68144.1| hypothetical protein B456_010G228200 [Gossypium r... 64 3e-08 >emb|CDO98062.1| unnamed protein product [Coffea canephora] Length = 1072 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ IGCWKTM Sbjct: 552 IVNFARIVPDGLLVFFPSYYLLDQCIGCWKTM 583 >ref|XP_011072337.1| PREDICTED: regulator of telomere elongation helicase 1 [Sesamum indicum] Length = 999 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWKTM Sbjct: 490 IVNFARIVPDGLLVFFPSYYLLDQCISCWKTM 521 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ IGCWK + Sbjct: 508 IVNFARIVPDGLLVFFPSYYLLDQCIGCWKNV 539 >ref|XP_010318571.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X5 [Solanum lycopersicum] Length = 870 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYY+L+Q IGCWKT+ Sbjct: 343 IVNFARVVPDGLLVFFPSYYILEQCIGCWKTL 374 >ref|XP_010318570.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X4 [Solanum lycopersicum] Length = 874 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYY+L+Q IGCWKT+ Sbjct: 347 IVNFARVVPDGLLVFFPSYYILEQCIGCWKTL 378 >ref|XP_010318569.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Solanum lycopersicum] Length = 973 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYY+L+Q IGCWKT+ Sbjct: 514 IVNFARVVPDGLLVFFPSYYILEQCIGCWKTL 545 >ref|XP_010318568.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Solanum lycopersicum] Length = 1040 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYY+L+Q IGCWKT+ Sbjct: 514 IVNFARVVPDGLLVFFPSYYILEQCIGCWKTL 545 >ref|XP_010318567.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Solanum lycopersicum] Length = 1041 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYY+L+Q IGCWKT+ Sbjct: 514 IVNFARVVPDGLLVFFPSYYILEQCIGCWKTL 545 >ref|XP_012450204.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X8 [Gossypium raimondii] Length = 1015 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450203.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X7 [Gossypium raimondii] Length = 964 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450202.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X6 [Gossypium raimondii] Length = 1015 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450200.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X5 [Gossypium raimondii] Length = 1021 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450198.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Gossypium raimondii] Length = 1024 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450197.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Gossypium raimondii] Length = 1024 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012450196.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Gossypium raimondii] Length = 1024 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >ref|XP_012073335.1| PREDICTED: regulator of telomere elongation helicase 1 homolog [Jatropha curcas] Length = 1056 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFAR+VPDGLLVFFPSYYLLDQ IGCWK + Sbjct: 507 IVNFARLVPDGLLVFFPSYYLLDQCIGCWKNV 538 >gb|KJB68147.1| hypothetical protein B456_010G228200 [Gossypium raimondii] Length = 823 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 318 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 349 >ref|XP_012450199.1| PREDICTED: regulator of telomere elongation helicase 1 isoform X4 [Gossypium raimondii] gi|763801191|gb|KJB68146.1| hypothetical protein B456_010G228200 [Gossypium raimondii] Length = 1021 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >gb|KJB68145.1| hypothetical protein B456_010G228200 [Gossypium raimondii] Length = 931 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538 >gb|KJB68144.1| hypothetical protein B456_010G228200 [Gossypium raimondii] Length = 1012 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 LVNFARIVPDGLLVFFPSYYLLDQSIGCWKTM 2 +VNFARIVPDGLLVFFPSYYLLDQ I CWK M Sbjct: 507 IVNFARIVPDGLLVFFPSYYLLDQCISCWKNM 538