BLASTX nr result
ID: Gardenia21_contig00027142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027142 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849237.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 gb|EYU27680.1| hypothetical protein MIMGU_mgv1a022067mg, partial... 66 3e-09 ref|XP_009625289.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-08 ref|XP_009625290.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-08 ref|XP_009773981.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_009773982.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 emb|CDP17864.1| unnamed protein product [Coffea canephora] 62 2e-07 ref|XP_006373596.1| hypothetical protein POPTR_0016s01140g [Popu... 59 7e-07 ref|XP_010271319.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 >ref|XP_012849237.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470-like isoform X2 [Erythranthe guttatus] Length = 555 Score = 65.9 bits (159), Expect(2) = 3e-09 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA+MVD+L +FV++S CKDHP V C+ HG++D Sbjct: 384 MLRDYGVRPRGKHYAIMVDLLGRAGRLEEAYEFVQVSPCKDHPAVWGALLGACRIHGNMD 443 Query: 134 LVNLVANNF 108 +V + A NF Sbjct: 444 IVKIAAKNF 452 Score = 21.9 bits (45), Expect(2) = 3e-09 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 FELEP+NAG Sbjct: 453 FELEPENAG 461 >gb|EYU27680.1| hypothetical protein MIMGU_mgv1a022067mg, partial [Erythranthe guttata] Length = 473 Score = 65.9 bits (159), Expect(2) = 3e-09 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA+MVD+L +FV++S CKDHP V C+ HG++D Sbjct: 252 MLRDYGVRPRGKHYAIMVDLLGRAGRLEEAYEFVQVSPCKDHPAVWGALLGACRIHGNMD 311 Query: 134 LVNLVANNF 108 +V + A NF Sbjct: 312 IVKIAAKNF 320 Score = 21.9 bits (45), Expect(2) = 3e-09 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 FELEP+NAG Sbjct: 321 FELEPENAG 329 >ref|XP_009625289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 isoform X1 [Nicotiana tomentosiformis] Length = 545 Score = 62.4 bits (150), Expect(2) = 7e-08 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA +VD+L +FVK S C +HPV+ CK HGD++ Sbjct: 385 MMRDYGLRPRGKHYAAIVDLLGRAGRLQEAHEFVKNSRCGEHPVLWGALLGACKIHGDIE 444 Query: 134 LVNLVANNF 108 +V L A NF Sbjct: 445 MVKLAARNF 453 Score = 20.8 bits (42), Expect(2) = 7e-08 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 F+LEP+NAG Sbjct: 454 FDLEPENAG 462 >ref|XP_009625290.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 isoform X2 [Nicotiana tomentosiformis] Length = 308 Score = 62.4 bits (150), Expect(2) = 7e-08 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA +VD+L +FVK S C +HPV+ CK HGD++ Sbjct: 148 MMRDYGLRPRGKHYAAIVDLLGRAGRLQEAHEFVKNSRCGEHPVLWGALLGACKIHGDIE 207 Query: 134 LVNLVANNF 108 +V L A NF Sbjct: 208 MVKLAARNF 216 Score = 20.8 bits (42), Expect(2) = 7e-08 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 F+LEP+NAG Sbjct: 217 FDLEPENAG 225 >ref|XP_009773981.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 isoform X1 [Nicotiana sylvestris] Length = 546 Score = 60.8 bits (146), Expect(2) = 2e-07 Identities = 31/69 (44%), Positives = 40/69 (57%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA +VD+L +FV+ S C +HPV+ CK HGD++ Sbjct: 386 MMRDYGLRPRGKHYAAIVDLLGRAGRLQEAHEFVQNSRCGEHPVLWGALLGACKIHGDIE 445 Query: 134 LVNLVANNF 108 +V L A NF Sbjct: 446 MVKLAARNF 454 Score = 20.8 bits (42), Expect(2) = 2e-07 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 F+LEP+NAG Sbjct: 455 FDLEPENAG 463 >ref|XP_009773982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 isoform X2 [Nicotiana sylvestris] Length = 320 Score = 60.8 bits (146), Expect(2) = 2e-07 Identities = 31/69 (44%), Positives = 40/69 (57%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA +VD+L +FV+ S C +HPV+ CK HGD++ Sbjct: 160 MMRDYGLRPRGKHYAAIVDLLGRAGRLQEAHEFVQNSRCGEHPVLWGALLGACKIHGDIE 219 Query: 134 LVNLVANNF 108 +V L A NF Sbjct: 220 MVKLAARNF 228 Score = 20.8 bits (42), Expect(2) = 2e-07 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 F+LEP+NAG Sbjct: 229 FDLEPENAG 237 >emb|CDP17864.1| unnamed protein product [Coffea canephora] Length = 705 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G P+GKHYA MVD+L +FV S CKDHPVV CK HG++D Sbjct: 375 MTRDYGIQPKGKHYAAMVDLLGRAGRLADAYEFVVNSPCKDHPVVWGALLGACKNHGNMD 434 Query: 134 LVNLVANNF 108 L + A NF Sbjct: 435 LAKIAAKNF 443 >ref|XP_006373596.1| hypothetical protein POPTR_0016s01140g [Populus trichocarpa] gi|550320530|gb|ERP51393.1| hypothetical protein POPTR_0016s01140g [Populus trichocarpa] Length = 509 Score = 58.9 bits (141), Expect(2) = 7e-07 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 MRRD G PRGKHYA MVD+L +FV + CK+H V+ CK HGD+D Sbjct: 348 MRRDYGIQPRGKHYAAMVDLLGRAGRLKEAYEFVVNAPCKEHSVLWGALLGACKIHGDMD 407 Query: 134 LVNLVANNF 108 L+ L A + Sbjct: 408 LIELAARKY 416 Score = 20.8 bits (42), Expect(2) = 7e-07 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 FEL+P+NAG Sbjct: 417 FELDPENAG 425 >ref|XP_010271319.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16470 [Nelumbo nucifera] Length = 439 Score = 55.5 bits (132), Expect(2) = 4e-06 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 10/69 (14%) Frame = -2 Query: 284 MRRDCGELPRGKHYAVMVDML----------DFVKISHCKDHPVV*SV*NEGCKYHGDVD 135 M RD G PRGKHYA MVD+L +FV S C+DH V+ C+ HG+++ Sbjct: 279 MSRDYGIRPRGKHYAAMVDLLGRAGRLNEAYEFVLNSPCEDHSVIWGALLGACRIHGNLE 338 Query: 134 LVNLVANNF 108 LV L A F Sbjct: 339 LVKLAAKKF 347 Score = 21.9 bits (45), Expect(2) = 4e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 109 FELEPQNAG 83 FELEP+NAG Sbjct: 348 FELEPENAG 356