BLASTX nr result
ID: Gardenia21_contig00026947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026947 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO96870.1| unnamed protein product [Coffea canephora] 138 2e-30 ref|XP_002265079.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 emb|CBI30729.3| unnamed protein product [Vitis vinifera] 106 8e-21 ref|XP_010529216.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_012463389.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-20 ref|XP_013607492.1| PREDICTED: pentatricopeptide repeat-containi... 102 9e-20 ref|XP_007025291.1| Pentatricopeptide repeat (PPR-like) superfam... 102 9e-20 ref|XP_010451379.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_009132265.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_013719427.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_013652988.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 gb|KQL29091.1| hypothetical protein SETIT_020193mg [Setaria ital... 101 3e-19 ref|XP_010106241.1| hypothetical protein L484_005106 [Morus nota... 101 3e-19 ref|XP_010436490.1| PREDICTED: pentatricopeptide repeat-containi... 101 3e-19 ref|XP_009420943.1| PREDICTED: pentatricopeptide repeat-containi... 101 3e-19 emb|CDX99419.1| BnaC01g11330D [Brassica napus] 101 3e-19 ref|XP_006414048.1| hypothetical protein EUTSA_v10024877mg [Eutr... 101 3e-19 ref|XP_004954764.1| PREDICTED: pentatricopeptide repeat-containi... 101 3e-19 ref|XP_006283500.1| hypothetical protein CARUB_v10004552mg [Caps... 101 3e-19 gb|EMT09030.1| hypothetical protein F775_05194 [Aegilops tauschii] 101 3e-19 >emb|CDO96870.1| unnamed protein product [Coffea canephora] Length = 516 Score = 138 bits (347), Expect = 2e-30 Identities = 68/76 (89%), Positives = 70/76 (92%) Frame = -1 Query: 228 FGEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHY 49 FGEQALKVFSEMVEN FKPN+VTFVSLLSACS AGLLFES EIF NMFSIYGI+P IEHY Sbjct: 338 FGEQALKVFSEMVENGFKPNDVTFVSLLSACSRAGLLFESHEIFDNMFSIYGIKPKIEHY 397 Query: 48 GCLVDLLGRSGLLKEA 1 GCLVDLLGR GLLKEA Sbjct: 398 GCLVDLLGRFGLLKEA 413 >ref|XP_002265079.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Vitis vinifera] Length = 536 Score = 106 bits (264), Expect = 8e-21 Identities = 50/75 (66%), Positives = 61/75 (81%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+ AL++FSEM+ FKPNEVTFV +LSACS AGLL E RE+F M ++GI+P IEHYG Sbjct: 353 GQHALQIFSEMLVEGFKPNEVTFVCVLSACSRAGLLDEGREMFNLMVHVHGIQPTIEHYG 412 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR GLL+EA Sbjct: 413 CMVDLLGRVGLLEEA 427 >emb|CBI30729.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 106 bits (264), Expect = 8e-21 Identities = 50/75 (66%), Positives = 61/75 (81%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+ AL++FSEM+ FKPNEVTFV +LSACS AGLL E RE+F M ++GI+P IEHYG Sbjct: 323 GQHALQIFSEMLVEGFKPNEVTFVCVLSACSRAGLLDEGREMFNLMVHVHGIQPTIEHYG 382 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR GLL+EA Sbjct: 383 CMVDLLGRVGLLEEA 397 >ref|XP_010529216.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308341|ref|XP_010529217.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308344|ref|XP_010529218.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308347|ref|XP_010529219.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308350|ref|XP_010529220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308353|ref|XP_010529221.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308356|ref|XP_010529222.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308359|ref|XP_010529224.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308362|ref|XP_010529225.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] gi|729308365|ref|XP_010529226.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Tarenaya hassleriana] Length = 534 Score = 104 bits (260), Expect = 2e-20 Identities = 48/76 (63%), Positives = 59/76 (77%) Frame = -1 Query: 228 FGEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHY 49 FG+ AL +FSEM+ F+PN VTFV +LSACSHAGLL E RE+FG M +YGI P +EHY Sbjct: 352 FGKVALGIFSEMLLEGFEPNNVTFVGVLSACSHAGLLDEGRELFGMMKRVYGIEPTVEHY 411 Query: 48 GCLVDLLGRSGLLKEA 1 GC+VDL GR G ++EA Sbjct: 412 GCMVDLFGRMGKVEEA 427 >ref|XP_012463389.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Gossypium raimondii] gi|763815318|gb|KJB82170.1| hypothetical protein B456_013G179200 [Gossypium raimondii] Length = 524 Score = 104 bits (259), Expect = 3e-20 Identities = 47/75 (62%), Positives = 61/75 (81%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+QAL++ S+M+E+ PNEVTF+S LSACSH GL E +E+F NM YG++P IEHYG Sbjct: 321 GKQALQLLSDMLESGVAPNEVTFLSALSACSHEGLFVEGQELFRNMVQCYGLKPMIEHYG 380 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR+GLL+EA Sbjct: 381 CVVDLLGRAGLLEEA 395 >ref|XP_013607492.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Brassica oleracea var. oleracea] Length = 536 Score = 102 bits (255), Expect = 9e-20 Identities = 45/75 (60%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL++FSEMV FKPN VTF+++LSAC+H GLL ++R++F M S+YG+ P+IEHYG Sbjct: 357 GNDALEIFSEMVYEGFKPNSVTFIAVLSACNHVGLLDQARKLFETMGSVYGVEPSIEHYG 416 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G +EA Sbjct: 417 CMVDLLGRLGRFEEA 431 >ref|XP_007025291.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590623325|ref|XP_007025292.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590623329|ref|XP_007025293.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590623333|ref|XP_007025294.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590623336|ref|XP_007025295.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508780657|gb|EOY27913.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508780658|gb|EOY27914.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508780659|gb|EOY27915.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508780660|gb|EOY27916.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508780661|gb|EOY27917.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 535 Score = 102 bits (255), Expect = 9e-20 Identities = 49/75 (65%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 GE AL++FSEM+ N F+PNEVTF+ LLSACS AGLL E IF M YGI+P IEH+G Sbjct: 354 GEHALEIFSEMLVNGFEPNEVTFIGLLSACSRAGLLNEGHHIFQIMVDDYGIQPTIEHFG 413 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLG+ GLL+EA Sbjct: 414 CMVDLLGQVGLLEEA 428 >ref|XP_010451379.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840, partial [Camelina sativa] Length = 490 Score = 102 bits (253), Expect = 1e-19 Identities = 45/75 (60%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+ AL++FSEMV FKPN +TFV +LSAC+H GLL ++R +F M S+YG+ P+IEHYG Sbjct: 311 GKDALEIFSEMVYEGFKPNGITFVGVLSACNHVGLLDQARNLFEMMNSVYGVEPSIEHYG 370 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G ++EA Sbjct: 371 CMVDLLGRMGKIEEA 385 >ref|XP_009132265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Brassica rapa] Length = 535 Score = 102 bits (253), Expect = 1e-19 Identities = 44/75 (58%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL++FSEMV FKPN +TF+++LSAC+H GLL ++R++F M S+YG+ P+IEHYG Sbjct: 356 GNDALEIFSEMVYEGFKPNGITFIAVLSACNHVGLLDQARKLFETMSSVYGVEPSIEHYG 415 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G +EA Sbjct: 416 CMVDLLGRLGRFEEA 430 >ref|XP_013719427.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Brassica napus] Length = 536 Score = 101 bits (252), Expect = 2e-19 Identities = 45/75 (60%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL +FSEMV FKPN VTF+++LSAC+H GLL ++R++F M S+YG+ P+IEHYG Sbjct: 357 GNDALGIFSEMVYEGFKPNSVTFIAVLSACNHVGLLDQARKLFETMGSVYGVEPSIEHYG 416 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G +EA Sbjct: 417 CMVDLLGRLGRFEEA 431 >ref|XP_013652988.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840-like [Brassica napus] Length = 424 Score = 101 bits (252), Expect = 2e-19 Identities = 44/75 (58%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL++FSEMV FKPN +TF+++LSAC+H GLL ++R++F M S+YG+ P+IEHYG Sbjct: 245 GNDALEIFSEMVYEGFKPNGITFIAVLSACNHVGLLDQARKLFETMGSVYGVEPSIEHYG 304 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G +EA Sbjct: 305 CMVDLLGRLGRFEEA 319 >gb|KQL29091.1| hypothetical protein SETIT_020193mg [Setaria italica] Length = 865 Score = 101 bits (251), Expect = 3e-19 Identities = 47/75 (62%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G +AL++F +M+ + PN VTFVS+LSACSHAGL+ E RE+FG M IY I P +EHYG Sbjct: 316 GRKALELFWDMIRSGVVPNTVTFVSVLSACSHAGLIEEGRELFGTMREIYNIGPHLEHYG 375 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR GLL+EA Sbjct: 376 CMVDLLGRGGLLEEA 390 >ref|XP_010106241.1| hypothetical protein L484_005106 [Morus notabilis] gi|587921741|gb|EXC09150.1| hypothetical protein L484_005106 [Morus notabilis] Length = 782 Score = 101 bits (251), Expect = 3e-19 Identities = 43/75 (57%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 GE ALK+F +M+E+ KP+ VTFV++LSACSHAGL+ + R +F M ++G+ P IEHY Sbjct: 560 GETALKIFHQMIESGLKPDNVTFVAILSACSHAGLITKGRSLFNQMSRVHGVEPQIEHYA 619 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR+GL++EA Sbjct: 620 CMVDLLGRAGLVQEA 634 >ref|XP_010436490.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840-like [Camelina sativa] Length = 878 Score = 101 bits (251), Expect = 3e-19 Identities = 44/75 (58%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+ AL++FSEMV FKPN +TFV +LSAC+H GLL ++R +F M S+YG+ P +EHYG Sbjct: 699 GKDALEIFSEMVYEGFKPNGITFVGVLSACNHVGLLDQARNLFEMMNSVYGVEPTVEHYG 758 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G ++EA Sbjct: 759 CMVDLLGRMGRIEEA 773 >ref|XP_009420943.1| PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Musa acuminata subsp. malaccensis] Length = 495 Score = 101 bits (251), Expect = 3e-19 Identities = 45/76 (59%), Positives = 60/76 (78%) Frame = -1 Query: 228 FGEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHY 49 + Q L +FS MV++ +PNEVTF+ +LSACSH+GL+ + R FG+MF Y IRP +EHY Sbjct: 293 YAYQCLDLFSRMVKDGVQPNEVTFIGVLSACSHSGLVEQGRYHFGSMFKDYSIRPKVEHY 352 Query: 48 GCLVDLLGRSGLLKEA 1 GC+VDLLGR+G+LKEA Sbjct: 353 GCMVDLLGRAGMLKEA 368 >emb|CDX99419.1| BnaC01g11330D [Brassica napus] Length = 472 Score = 101 bits (251), Expect = 3e-19 Identities = 44/75 (58%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL++FSEMV FKPN VTF+++LSAC+H GLL ++R++F M S+YG+ P+IEHYG Sbjct: 325 GNDALEIFSEMVYEGFKPNSVTFIAVLSACNHVGLLDQARKLFETMGSVYGVEPSIEHYG 384 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G ++A Sbjct: 385 CMVDLLGRFGRTEQA 399 >ref|XP_006414048.1| hypothetical protein EUTSA_v10024877mg [Eutrema salsugineum] gi|557115218|gb|ESQ55501.1| hypothetical protein EUTSA_v10024877mg [Eutrema salsugineum] Length = 535 Score = 101 bits (251), Expect = 3e-19 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G AL++FSEMV FKPN +TF++ LSAC+H G+L ++R +F M S+YG+ P IEHYG Sbjct: 356 GNDALEIFSEMVHEGFKPNSITFIATLSACNHVGMLDQARRLFETMNSVYGVEPTIEHYG 415 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G +EA Sbjct: 416 CMVDLLGRMGKFEEA 430 >ref|XP_004954764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Setaria italica] Length = 452 Score = 101 bits (251), Expect = 3e-19 Identities = 47/75 (62%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G +AL++F +M+ + PN VTFVS+LSACSHAGL+ E RE+FG M IY I P +EHYG Sbjct: 243 GRKALELFWDMIRSGVVPNTVTFVSVLSACSHAGLIEEGRELFGTMREIYNIGPHLEHYG 302 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR GLL+EA Sbjct: 303 CMVDLLGRGGLLEEA 317 >ref|XP_006283500.1| hypothetical protein CARUB_v10004552mg [Capsella rubella] gi|482552205|gb|EOA16398.1| hypothetical protein CARUB_v10004552mg [Capsella rubella] Length = 537 Score = 101 bits (251), Expect = 3e-19 Identities = 44/75 (58%), Positives = 59/75 (78%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G+ AL++FSEMV FKPN +TF+ +LSAC+H GLL ++R +F M S+YGI P +EHYG Sbjct: 358 GKDALEIFSEMVYEGFKPNGITFIGVLSACNHVGLLDQARRLFEMMNSVYGIEPTVEHYG 417 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR G ++EA Sbjct: 418 CMVDLLGRMGKIEEA 432 >gb|EMT09030.1| hypothetical protein F775_05194 [Aegilops tauschii] Length = 632 Score = 101 bits (251), Expect = 3e-19 Identities = 46/75 (61%), Positives = 60/75 (80%) Frame = -1 Query: 225 GEQALKVFSEMVENSFKPNEVTFVSLLSACSHAGLLFESREIFGNMFSIYGIRPAIEHYG 46 G +AL++F +M+ + PN VTFVS+LSACSHAGL+ + RE+F NM IY I+P +EHYG Sbjct: 415 GIKALELFEDMLRSGIVPNSVTFVSVLSACSHAGLIQQGRELFDNMRRIYNIKPQLEHYG 474 Query: 45 CLVDLLGRSGLLKEA 1 C+VDLLGR GLL+EA Sbjct: 475 CIVDLLGRGGLLEEA 489