BLASTX nr result
ID: Gardenia21_contig00026872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026872 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074478.1| PREDICTED: exocyst complex component SEC3A [... 67 5e-09 emb|CDP07584.1| unnamed protein product [Coffea canephora] 66 1e-08 ref|XP_011083761.1| PREDICTED: exocyst complex component SEC3A [... 64 4e-08 ref|XP_012845580.1| PREDICTED: exocyst complex component SEC3A-l... 64 4e-08 ref|XP_010024844.1| PREDICTED: exocyst complex component SEC3A [... 64 6e-08 gb|KCW88047.1| hypothetical protein EUGRSUZ_A004732, partial [Eu... 64 6e-08 gb|KCW88046.1| hypothetical protein EUGRSUZ_A004732, partial [Eu... 64 6e-08 ref|XP_010323449.1| PREDICTED: exocyst complex component SEC3A-l... 63 8e-08 ref|XP_006354257.1| PREDICTED: exocyst complex component SEC3A-l... 63 8e-08 ref|XP_004242958.1| PREDICTED: exocyst complex component SEC3A-l... 63 8e-08 ref|XP_012834297.1| PREDICTED: exocyst complex component SEC3A-l... 63 1e-07 gb|EYU40073.1| hypothetical protein MIMGU_mgv1a001177mg [Erythra... 63 1e-07 ref|XP_012571391.1| PREDICTED: exocyst complex component SEC3A-l... 62 1e-07 gb|EPS72833.1| hypothetical protein M569_01920 [Genlisea aurea] 62 1e-07 ref|XP_010106069.1| hypothetical protein L484_021247 [Morus nota... 62 2e-07 ref|XP_007017431.1| Exocyst complex component sec3A isoform 1 [T... 62 2e-07 ref|XP_009365627.1| PREDICTED: exocyst complex component SEC3A-l... 62 2e-07 ref|XP_014500359.1| PREDICTED: exocyst complex component SEC3A-l... 61 3e-07 gb|KOM51556.1| hypothetical protein LR48_Vigan09g021500 [Vigna a... 61 3e-07 ref|XP_004501046.1| PREDICTED: exocyst complex component SEC3A-l... 61 3e-07 >ref|XP_011074478.1| PREDICTED: exocyst complex component SEC3A [Sesamum indicum] Length = 886 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES EQ TRF STIIYY Sbjct: 738 NSLYDLANVVPTLAKFYHQASESYEQACTRFISTIIYY 775 >emb|CDP07584.1| unnamed protein product [Coffea canephora] Length = 888 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TRF STIIYY Sbjct: 740 NSLYDLANVVPTLAKFYHQASEAYEQACTRFISTIIYY 777 >ref|XP_011083761.1| PREDICTED: exocyst complex component SEC3A [Sesamum indicum] Length = 863 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES +Q+ TR+ +TIIYY Sbjct: 715 NSLYDLANVVPTLAKFYHQASESYDQSCTRYINTIIYY 752 >ref|XP_012845580.1| PREDICTED: exocyst complex component SEC3A-like [Erythranthe guttatus] gi|604346711|gb|EYU45091.1| hypothetical protein MIMGU_mgv1a001124mg [Erythranthe guttata] Length = 882 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVV TLAKFYHQASES EQ TRF STIIYY Sbjct: 734 NSLYDLANVVATLAKFYHQASESYEQACTRFISTIIYY 771 >ref|XP_010024844.1| PREDICTED: exocyst complex component SEC3A [Eucalyptus grandis] Length = 877 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TRF S IIYY Sbjct: 729 NSLYDLANVVPTLAKFYHQASEAYEQACTRFISMIIYY 766 >gb|KCW88047.1| hypothetical protein EUGRSUZ_A004732, partial [Eucalyptus grandis] Length = 452 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TRF S IIYY Sbjct: 368 NSLYDLANVVPTLAKFYHQASEAYEQACTRFISMIIYY 405 >gb|KCW88046.1| hypothetical protein EUGRSUZ_A004732, partial [Eucalyptus grandis] Length = 516 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TRF S IIYY Sbjct: 368 NSLYDLANVVPTLAKFYHQASEAYEQACTRFISMIIYY 405 >ref|XP_010323449.1| PREDICTED: exocyst complex component SEC3A-like isoform X1 [Solanum lycopersicum] Length = 885 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES EQ TR +TIIYY Sbjct: 736 NSLYDLANVVPTLAKFYHQASESYEQACTRHINTIIYY 773 >ref|XP_006354257.1| PREDICTED: exocyst complex component SEC3A-like [Solanum tuberosum] Length = 884 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES EQ TR +TIIYY Sbjct: 736 NSLYDLANVVPTLAKFYHQASESYEQACTRHINTIIYY 773 >ref|XP_004242958.1| PREDICTED: exocyst complex component SEC3A-like isoform X2 [Solanum lycopersicum] Length = 884 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES EQ TR +TIIYY Sbjct: 736 NSLYDLANVVPTLAKFYHQASESYEQACTRHINTIIYY 773 >ref|XP_012834297.1| PREDICTED: exocyst complex component SEC3A-like [Erythranthe guttatus] Length = 653 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLY+LANVV TLAKFYHQASES EQ+ TRF STIIYY Sbjct: 505 NSLYELANVVATLAKFYHQASESYEQSCTRFISTIIYY 542 >gb|EYU40073.1| hypothetical protein MIMGU_mgv1a001177mg [Erythranthe guttata] Length = 872 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLY+LANVV TLAKFYHQASES EQ+ TRF STIIYY Sbjct: 724 NSLYELANVVATLAKFYHQASESYEQSCTRFISTIIYY 761 >ref|XP_012571391.1| PREDICTED: exocyst complex component SEC3A-like isoform X3 [Cicer arietinum] Length = 858 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYYV 150 +SLYDLANVVPTLAKFYHQASE+ EQ+ TR S IIYY+ Sbjct: 733 NSLYDLANVVPTLAKFYHQASEAYEQSCTRHISMIIYYI 771 >gb|EPS72833.1| hypothetical protein M569_01920 [Genlisea aurea] Length = 885 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLY+LANVVPTLAKFYHQASES EQ +RF STIIY+ Sbjct: 737 NSLYELANVVPTLAKFYHQASESYEQACSRFISTIIYF 774 >ref|XP_010106069.1| hypothetical protein L484_021247 [Morus notabilis] gi|587919885|gb|EXC07339.1| hypothetical protein L484_021247 [Morus notabilis] Length = 841 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIY 156 +SLYDLANVVPTLAKFYHQASE+ EQ TR+ STIIY Sbjct: 595 NSLYDLANVVPTLAKFYHQASEAYEQACTRYISTIIY 631 >ref|XP_007017431.1| Exocyst complex component sec3A isoform 1 [Theobroma cacao] gi|508722759|gb|EOY14656.1| Exocyst complex component sec3A isoform 1 [Theobroma cacao] Length = 885 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASES EQ TR S IIYY Sbjct: 737 NSLYDLANVVPTLAKFYHQASESYEQACTRHISMIIYY 774 >ref|XP_009365627.1| PREDICTED: exocyst complex component SEC3A-like [Pyrus x bretschneideri] Length = 882 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIY 156 +SLYDLANVVPTLAKFYHQASE+ EQ TR NS IIY Sbjct: 734 NSLYDLANVVPTLAKFYHQASEAYEQACTRHNSMIIY 770 >ref|XP_014500359.1| PREDICTED: exocyst complex component SEC3A-like [Vigna radiata var. radiata] Length = 879 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TR S IIYY Sbjct: 730 NSLYDLANVVPTLAKFYHQASEAYEQACTRHISVIIYY 767 >gb|KOM51556.1| hypothetical protein LR48_Vigan09g021500 [Vigna angularis] Length = 776 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ TR S IIYY Sbjct: 627 NSLYDLANVVPTLAKFYHQASEAYEQACTRHISVIIYY 664 >ref|XP_004501046.1| PREDICTED: exocyst complex component SEC3A-like isoform X2 [Cicer arietinum] Length = 880 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 266 SSLYDLANVVPTLAKFYHQASESCEQTYTRFNSTIIYY 153 +SLYDLANVVPTLAKFYHQASE+ EQ+ TR S IIYY Sbjct: 731 NSLYDLANVVPTLAKFYHQASEAYEQSCTRHISMIIYY 768