BLASTX nr result
ID: Gardenia21_contig00026871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026871 (677 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06847.1| unnamed protein product [Coffea canephora] 74 2e-11 >emb|CDP06847.1| unnamed protein product [Coffea canephora] Length = 149 Score = 73.9 bits (180), Expect(2) = 2e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 582 MLSIYDQHTLCRSPKIIETKENLEDLILEMSIVLAYNTRTRDLWK 448 MLSIYDQ+T C SPKIIETKENL DLIL+MS VLAYNTR DLW+ Sbjct: 1 MLSIYDQYTGCSSPKIIETKENLGDLILKMSFVLAYNTRILDLWE 45 Score = 22.7 bits (47), Expect(2) = 2e-11 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -2 Query: 451 ERRVIYSSWLLENLSKH----VIFYLVCIVIYLLLP 356 ERRVIYSS + H IFY V + P Sbjct: 45 ERRVIYSSMAARKYNSHSVKVSIFYSVFYTFHSAAP 80