BLASTX nr result
ID: Gardenia21_contig00026771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026771 (487 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08476.1| unnamed protein product [Coffea canephora] 41 4e-07 >emb|CDP08476.1| unnamed protein product [Coffea canephora] Length = 494 Score = 40.8 bits (94), Expect(2) = 4e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 231 NILCNILSFLDTKFAASTSILSTR*RFLTLGL 136 +IL NILSFL TK AASTSILSTR R++ L L Sbjct: 56 HILFNILSFLRTKEAASTSILSTRWRYIFLDL 87 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = -1 Query: 316 MAE*STKCFKSSAFP*NDQNPPGKAAIGQHPLQHSL 209 MAE + KC K+S FP NDQNP K+A+ P++ +L Sbjct: 1 MAERNPKCLKASFFPQNDQNPSEKSAVRTEPMKANL 36