BLASTX nr result
ID: Gardenia21_contig00026559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026559 (201 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173482.1| hypothetical protein NitaMp145 [Nicotiana tabac... 52 2e-09 ref|YP_006291826.1| orf42 (mitochondrion) [Daucus carota subsp. ... 52 5e-09 ref|YP_009049760.1| hypothetical protein (mitochondrion) [Capsic... 52 1e-08 gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium r... 50 2e-08 ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macroc... 62 2e-07 ref|NP_064035.1| orf110a gene product (mitochondrion) [Beta vulg... 53 1e-06 >ref|YP_173482.1| hypothetical protein NitaMp145 [Nicotiana tabacum] gi|56806647|dbj|BAD83548.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 103 Score = 52.0 bits (123), Expect(2) = 2e-09 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 88 GLVRTQSSLVRQNWIKKRECSTGTTANKL 2 GLVR+QS LVR+NW KKRECSTGTTAN + Sbjct: 73 GLVRSQSCLVRRNWTKKRECSTGTTANNV 101 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -1 Query: 135 RYRFILRTWFSLTTLRG 85 RYRFILRTW SLTTLRG Sbjct: 57 RYRFILRTWSSLTTLRG 73 >ref|YP_006291826.1| orf42 (mitochondrion) [Daucus carota subsp. sativus] gi|374081988|gb|AEY81180.1| orf42 (mitochondrion) [Daucus carota subsp. sativus] Length = 133 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 88 GLVRTQSSLVRQNWIKKRECSTGTTANK 5 GLVR+QS LVR+NW KK+ECSTGTTANK Sbjct: 71 GLVRSQSCLVRRNWAKKKECSTGTTANK 98 Score = 34.7 bits (78), Expect(2) = 5e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 135 RYRFILRTWFSLTTLRG 85 RYRFIL TW SLTTLRG Sbjct: 55 RYRFILHTWSSLTTLRG 71 >ref|YP_009049760.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751875|gb|AIG89962.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752032|gb|AIG90118.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 103 Score = 52.0 bits (123), Expect(2) = 1e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 88 GLVRTQSSLVRQNWIKKRECSTGTTANKL 2 GLVR+QS LVR+NW KKRECSTGTTAN + Sbjct: 73 GLVRSQSCLVRRNWTKKRECSTGTTANNV 101 Score = 33.9 bits (76), Expect(2) = 1e-08 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 135 RYRFILRTWFSLTTLRG 85 RYRFI RTW SLTTLRG Sbjct: 57 RYRFIPRTWSSLTTLRG 73 >gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium raimondii] Length = 732 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -3 Query: 88 GLVRTQSSLVRQNWIKKRECSTGTTANK 5 GLVR+QS LVR+NW KKREC TGTT NK Sbjct: 160 GLVRSQSCLVRRNWTKKRECLTGTTVNK 187 Score = 35.4 bits (80), Expect(2) = 2e-08 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 135 RYRFILRTWFSLTTLRG 85 RYRFILRTW +LTTLRG Sbjct: 144 RYRFILRTWSNLTTLRG 160 >ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macrocarpa] gi|345500071|emb|CBX24887.1| hypothetical protein [Beta macrocarpa] Length = 160 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 5 FVGRCSGRALSFLYPILSYQRRLSSYQP-RRVVRLNHVRRMNLYLICTLSRRLSVQMS 175 FVGRCSGRALSFL I SYQ R +SYQP + RLN VRRMNLYL ++ R + S Sbjct: 98 FVGRCSGRALSFLCLIPSYQTRRTSYQPVKGCERLNQVRRMNLYLCTEVAGRRPLNCS 155 >ref|NP_064035.1| orf110a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049336|dbj|BAA99346.1| orf110a (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 110 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 4 ICWPLFRSSTLFSLSNSVLPKKTEFLPTPKSCE 102 +C PLFR STL SLSNSVLP KT+FLPT + CE Sbjct: 32 LCRPLFRPSTLLSLSNSVLPDKTDFLPTREGCE 64 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 101 RLNHVRRMNLYLICT 145 RLN VRRMNLYL CT Sbjct: 65 RLNQVRRMNLYL-CT 78