BLASTX nr result
ID: Gardenia21_contig00026525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00026525 (619 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05298.1| unnamed protein product [Coffea canephora] 62 3e-07 >emb|CDP05298.1| unnamed protein product [Coffea canephora] Length = 291 Score = 62.0 bits (149), Expect = 3e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 619 YGGRKSLKKQNTSETTGDIRGFNSNFSGKKRKR 521 YGGRK L KQNTSETT D+RGFN NFSG+KRKR Sbjct: 259 YGGRKGLNKQNTSETTSDVRGFNGNFSGRKRKR 291