BLASTX nr result
ID: Gardenia21_contig00025974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025974 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00655.1| unnamed protein product [Coffea canephora] 61 3e-07 >emb|CDP00655.1| unnamed protein product [Coffea canephora] Length = 639 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/54 (57%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -2 Query: 203 TNCPHNFHCGNLTNQLGFPFFDSSHPSNCGLFMLICEAAPVPKI-TFDFLYWPW 45 T CP +F+CGNLT +GFPFF+SS S+CGL L CEA P PKI F F W Sbjct: 33 TTCPESFNCGNLTG-VGFPFFNSSGSSHCGLLELDCEAKPSPKIAVFGFSEDQW 85