BLASTX nr result
ID: Gardenia21_contig00025811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025811 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00334.1| unnamed protein product [Coffea canephora] 89 2e-15 >emb|CDP00334.1| unnamed protein product [Coffea canephora] Length = 292 Score = 88.6 bits (218), Expect = 2e-15 Identities = 46/56 (82%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -2 Query: 166 MSEILTVHADRFVKPVQEIKPYGIADEKQQGEMVGPSISSAPRP-EEEVVVTVGEN 2 MSEIL VHADRFVKPVQEI PYGI DEK Q EMVGPS S APRP EEEVVV +GEN Sbjct: 1 MSEILAVHADRFVKPVQEINPYGIVDEKPQREMVGPSTSLAPRPEEEEVVVMMGEN 56