BLASTX nr result
ID: Gardenia21_contig00025684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025684 (285 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08343.1| unnamed protein product [Coffea canephora] 124 2e-26 >emb|CDP08343.1| unnamed protein product [Coffea canephora] Length = 517 Score = 124 bits (312), Expect = 2e-26 Identities = 60/66 (90%), Positives = 62/66 (93%) Frame = +3 Query: 87 MEGRGEEDPFGSLIGLCQITSSQEQKLQSCPFALESENFPDAVDSLPSQYSPNPPSSEPP 266 ME RGEEDPFGSLI LCQITSSQE KLQ+CPFALESE FPDAVDSLPSQYSPNPP+SEPP Sbjct: 1 MERRGEEDPFGSLIKLCQITSSQELKLQNCPFALESEKFPDAVDSLPSQYSPNPPASEPP 60 Query: 267 GIIMVS 284 GIIMVS Sbjct: 61 GIIMVS 66