BLASTX nr result
ID: Gardenia21_contig00025654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025654 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06410.1| unnamed protein product [Coffea canephora] 72 2e-10 >emb|CDP06410.1| unnamed protein product [Coffea canephora] Length = 153 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/47 (76%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -3 Query: 522 KEKGKFVPLLHLQGTMSLSVDKHFSFPYVRTLHV-FFLSDWGCTSHF 385 K+K F L LQGTMSLSVDKHFSFPYVRTLHV FF DW CTSHF Sbjct: 110 KKKASF---LRLQGTMSLSVDKHFSFPYVRTLHVFFFFPDWDCTSHF 153