BLASTX nr result
ID: Gardenia21_contig00025648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025648 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20917.1| unnamed protein product [Coffea canephora] 91 3e-16 >emb|CDP20917.1| unnamed protein product [Coffea canephora] Length = 399 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 217 MHNLYGYVHVIFHAVRHY*SCMIILLIVRKESCLMAFKVVSCVVDDTC 74 MHNLYGYVHVIF AVRHY SCMI+LLIVRKE+CL+AFKVVSCVV++TC Sbjct: 1 MHNLYGYVHVIFRAVRHYQSCMIVLLIVRKEACLIAFKVVSCVVNNTC 48