BLASTX nr result
ID: Gardenia21_contig00025622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025622 (204 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00597.1| unnamed protein product [Coffea canephora] 58 3e-06 >emb|CDP00597.1| unnamed protein product [Coffea canephora] Length = 840 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/66 (53%), Positives = 35/66 (53%) Frame = -2 Query: 200 SDPQPMDTSEPVTESQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFTDMISTSSAASG 21 SDPQPMDTSEPV ESQ LFTDMISTSSAASG Sbjct: 48 SDPQPMDTSEPVNESQPTSKTVPQAAAASTADPAPPPPRKRRRRKKLFTDMISTSSAASG 107 Query: 20 LRVLRP 3 LRVLRP Sbjct: 108 LRVLRP 113