BLASTX nr result
ID: Gardenia21_contig00025479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025479 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13480.1| unnamed protein product [Coffea canephora] 60 5e-07 >emb|CDP13480.1| unnamed protein product [Coffea canephora] Length = 72 Score = 60.5 bits (145), Expect = 5e-07 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 3/68 (4%) Frame = -1 Query: 230 APAATEPLNLELFKYRNNP---SPCLLSPQIS*ASSSFLADPPFSSIAISYKAFKDQNPK 60 APAAT PL+L++FK +N S L S ++ S PPFSSI I YKA +D NP+ Sbjct: 5 APAATRPLSLDVFKNQNPQLLASSTLRSAELLLLFSQIRHLPPFSSITIFYKALEDHNPR 64 Query: 59 LSRGTEVF 36 LSRGT VF Sbjct: 65 LSRGTAVF 72