BLASTX nr result
ID: Gardenia21_contig00025451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025451 (196 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009784754.1| PREDICTED: putative F-box/kelch-repeat prote... 57 4e-06 >ref|XP_009784754.1| PREDICTED: putative F-box/kelch-repeat protein At1g15680 [Nicotiana sylvestris] Length = 462 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +2 Query: 2 YFESSVTVTFQQLGFSCFSIWVLDDYNTGDWHLLHRVNQSDILFGNTLQRRVFSP--PIP 175 Y E S+ ++ GFS FS+WVLDDY++ +W L HRV DI+F + + + P P Sbjct: 305 YIEVSLVPSYP-FGFSGFSVWVLDDYDSSNWSLQHRVKIRDIVFDDISMSKALTGLIPTP 363 Query: 176 VCYHPFD 196 + +HP D Sbjct: 364 IAFHPLD 370