BLASTX nr result
ID: Gardenia21_contig00025388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025388 (576 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18308.1| unnamed protein product [Coffea canephora] 63 1e-07 >emb|CDP18308.1| unnamed protein product [Coffea canephora] Length = 711 Score = 62.8 bits (151), Expect = 1e-07 Identities = 38/63 (60%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = -1 Query: 180 MGCVTSKQAVSVTPAFDHSGVLREN---XXXXXXXXXXXXXXXXXXXXXXLEMDLKKVKK 10 MGCVTSKQAVSVTPAFDHSGVLREN LEMDLKKVKK Sbjct: 1 MGCVTSKQAVSVTPAFDHSGVLRENGAGGIGGGAFGSGRSRVGSGGLGLGLEMDLKKVKK 60 Query: 9 RGS 1 RGS Sbjct: 61 RGS 63