BLASTX nr result
ID: Gardenia21_contig00025307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025307 (611 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08918.1| unnamed protein product [Coffea canephora] 57 6e-06 >emb|CDP08918.1| unnamed protein product [Coffea canephora] Length = 683 Score = 57.4 bits (137), Expect = 6e-06 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 139 MGNNKRGITVTXXXXXXXXXXSRFPVAAVLIFCLVVSPSFFFLVGR 2 MG NKRGITV SR P AAVLIFCLVVSPSF FLVGR Sbjct: 1 MGTNKRGITVAGKSSKGGGYGSRLPGAAVLIFCLVVSPSFLFLVGR 46