BLASTX nr result
ID: Gardenia21_contig00025306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025306 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05499.1| unnamed protein product [Coffea canephora] 45 2e-09 >emb|CDP05499.1| unnamed protein product [Coffea canephora] Length = 866 Score = 45.1 bits (105), Expect(2) = 2e-09 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = -3 Query: 110 QCFHSYNFHRVESDHVYFTHLSIYFDDKMSLVYKL 6 +CFHSY+FH + + V FTH+ I K SLVYKL Sbjct: 520 KCFHSYDFHYIPPNDVKFTHIDISLQQKNSLVYKL 554 Score = 43.1 bits (100), Expect(2) = 2e-09 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -2 Query: 306 KTCYIHDLLRYVCFKKGTDSKSLWPICRYSQISLLT 199 KTC +HDLLR +C KK D+ L P C + QISL + Sbjct: 472 KTCQVHDLLRDLCVKKAKDNLFLQPSCGHKQISLFS 507