BLASTX nr result
ID: Gardenia21_contig00025262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025262 (645 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADV15987.1| ATP synthase F0 subunit 6, partial (mitochondrion... 58 5e-06 ref|YP_009045813.1| ATP synthase subunit 6 (mitochondrion) [Bati... 57 7e-06 gb|ACD02155.1| ATPase subunit 6, partial (mitochondrion) [Celast... 57 7e-06 gb|ALJ78510.1| Atp6 (mitochondrion) [Malus hupehensis var. mengs... 57 9e-06 ref|YP_009041194.1| ATP synthase F0 subunit 6 (mitochondrion) [R... 57 9e-06 ref|YP_006666132.1| ATP synthase F0 subunit 6 (mitochondrion) [M... 57 9e-06 gb|ADV15986.1| ATP synthase F0 subunit 6, partial (mitochondrion... 57 9e-06 gb|ACD02171.1| ATPase subunit 6, partial (mitochondrion) [Liquid... 57 9e-06 gb|ACD02167.1| ATPase subunit 6, partial (mitochondrion) [Gunner... 57 9e-06 gb|ACD02158.1| ATPase subunit 6, partial (mitochondrion) [Daphni... 57 9e-06 gb|ACD02157.1| ATPase subunit 6, partial (mitochondrion) [Corylo... 57 9e-06 >gb|ADV15987.1| ATP synthase F0 subunit 6, partial (mitochondrion) [Pentas lanceolata] Length = 204 Score = 57.8 bits (138), Expect = 5e-06 Identities = 37/81 (45%), Positives = 39/81 (48%), Gaps = 12/81 (14%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG------------FLSCXXX 146 RIS+TF LF NLQGMIPYS T TSHFLI L F+IFIG FLS Sbjct: 54 RISVTFTFSLFRNLQGMIPYSFTVTSHFLITLGLSFSIFIGITIVGFQKNGLHFLSFFLP 113 Query: 147 XXXXXXXXXXXXXXXXISHCF 209 ISHCF Sbjct: 114 AGVPLPLAPFLVLLELISHCF 134 >ref|YP_009045813.1| ATP synthase subunit 6 (mitochondrion) [Batis maritima] gi|655168587|gb|AIC83416.1| ATP synthase subunit 6 (mitochondrion) (mitochondrion) [Batis maritima] Length = 315 Score = 57.4 bits (137), Expect = 7e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LF NLQGMIPYS T TSHFLI L F+IFIG Sbjct: 152 RISVTFTFSLFRNLQGMIPYSFTVTSHFLITLGLSFSIFIG 192 >gb|ACD02155.1| ATPase subunit 6, partial (mitochondrion) [Celastrus scandens] Length = 213 Score = 57.4 bits (137), Expect = 7e-06 Identities = 36/81 (44%), Positives = 40/81 (49%), Gaps = 12/81 (14%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG------------FLSCXXX 146 RIS+TF LLF N+QGMIPYS T TSHFLI L F++FIG FLS Sbjct: 57 RISVTFTFLLFLNIQGMIPYSFTVTSHFLITLGLSFSLFIGITIVGFQRNGLHFLSFSLP 116 Query: 147 XXXXXXXXXXXXXXXXISHCF 209 ISHCF Sbjct: 117 AGVPMPLAPFLVLLELISHCF 137 >gb|ALJ78510.1| Atp6 (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 388 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 205 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 245 >ref|YP_009041194.1| ATP synthase F0 subunit 6 (mitochondrion) [Rhazya stricta] gi|645929318|gb|AIB08841.1| ATP synthase F0 subunit 6 (mitochondrion) [Rhazya stricta] Length = 272 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 95 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 135 >ref|YP_006666132.1| ATP synthase F0 subunit 6 (mitochondrion) [Malus domestica] gi|401661935|emb|CBX33394.1| ATP synthase F0 subunit 6 (mitochondrion) [Malus domestica] Length = 327 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 142 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 182 >gb|ADV15986.1| ATP synthase F0 subunit 6, partial (mitochondrion) [Nerium oleander] Length = 204 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 54 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 94 >gb|ACD02171.1| ATPase subunit 6, partial (mitochondrion) [Liquidambar styraciflua] Length = 213 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 57 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 97 >gb|ACD02167.1| ATPase subunit 6, partial (mitochondrion) [Gunnera monoica] Length = 213 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 57 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 97 >gb|ACD02158.1| ATPase subunit 6, partial (mitochondrion) [Daphniphyllum macropodum] Length = 213 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 57 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 97 >gb|ACD02157.1| ATPase subunit 6, partial (mitochondrion) [Corylopsis glabrescens f. gotoana] Length = 213 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 3 RISITFI*LLFHNLQGMIPYSLTFTSHFLIILVSHFAIFIG 125 RIS+TF LLF N QGMIPYS T TSHFLI L F+IFIG Sbjct: 57 RISVTFTFLLFRNPQGMIPYSFTVTSHFLITLGLSFSIFIG 97