BLASTX nr result
ID: Gardenia21_contig00025234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025234 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12744.1| unnamed protein product [Coffea canephora] 60 8e-07 >emb|CDP12744.1| unnamed protein product [Coffea canephora] Length = 624 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/61 (55%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = -3 Query: 265 MSNPYDSRYTDATSYRNRRSDITGAXXXXXXXXXXXXXXXXXSYDR-------GGPMGAP 107 M NPYDSRYTDA SYRNRRSDI GA SYDR GGPMGAP Sbjct: 1 MFNPYDSRYTDAGSYRNRRSDIMGAAPPIVPPPMMGSGGLGPSYDRGGPPPRYGGPMGAP 60 Query: 106 P 104 P Sbjct: 61 P 61