BLASTX nr result
ID: Gardenia21_contig00025045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025045 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB46757.1| hypothetical protein B456_008G175600 [Gossypium r... 59 2e-06 >gb|KJB46757.1| hypothetical protein B456_008G175600 [Gossypium raimondii] Length = 69 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 138 MLGASSNRKMMKAPGRNFYIFRDEFELDPAGYFRSLRE 251 + +SSNRK MKAPGRN+ I+RD+FE DPA YFR+LR+ Sbjct: 32 LFSSSSNRKTMKAPGRNYRIYRDDFERDPASYFRNLRK 69