BLASTX nr result
ID: Gardenia21_contig00023144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00023144 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98216.1| unnamed protein product [Coffea canephora] 68 3e-09 >emb|CDO98216.1| unnamed protein product [Coffea canephora] Length = 116 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 1 ASAKDAVADLFGILIAVLALSFSGSFNIPVGHGSDHSGQVKRVEMV 138 ASAKDAVADLFG LIAV AL + SFNIP G GSD+S QVKRVEMV Sbjct: 71 ASAKDAVADLFGTLIAVFALWLTESFNIPAGLGSDYSDQVKRVEMV 116