BLASTX nr result
ID: Gardenia21_contig00022965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022965 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKZ24602.1| ATPase subunit 8 (mitochondrion) [Xanthisma spinu... 68 2e-09 gb|AKZ24598.1| ATPase subunit 8 (mitochondrion) [Heterotheca vil... 68 2e-09 gb|AKZ24593.1| ATPase subunit 8 (mitochondrion) [Erigeron bellid... 68 2e-09 ref|YP_005090417.1| atp8 gene product (mitochondrion) [Boea hygr... 68 2e-09 gb|ALF04055.1| ATPase subunit 8 (mitochondrion) [Cannabis sativa] 67 4e-09 gb|AKZ24646.1| ATPase subunit 8 (mitochondrion) [Veronica americ... 67 5e-09 gb|AKZ24644.1| ATPase subunit 8, partial (mitochondrion) [Verbas... 67 5e-09 gb|AKZ24642.1| ATPase subunit 8 (mitochondrion) [Penstemon angus... 67 5e-09 gb|AKZ24645.1| ATPase subunit 8 (mitochondrion) [Verbena hastata] 67 5e-09 ref|YP_003587373.1| ATPase subunit 8 [Cucurbita pepo] gi|2591568... 67 5e-09 ref|YP_003587237.1| ATPase subunit 8 [Citrullus lanatus] gi|2591... 67 5e-09 gb|AGL75389.1| ATPase subunit 8 (mitochondrion) [Utricularia gibba] 67 5e-09 emb|CAC29087.1| hypoghetical protein [Olea europaea var. sylvest... 67 5e-09 gb|AHX81462.1| ATPase subunit 8 (mitochondrion) [Licania sprucei... 67 7e-09 gb|ALE29222.1| ATPase subunit 8 (mitochondrion) [Heuchera parvif... 66 9e-09 gb|AKZ24596.1| ATPase subunit 8 (mitochondrion) [Solidago gigantea] 66 9e-09 gb|AKJ25439.1| ATP synthase F0 subunit 8 (mitochondrion) [Melian... 66 9e-09 ref|YP_009041183.1| ATPase subunit 8 (mitochondrion) [Rhazya str... 66 9e-09 ref|YP_002608379.1| ATPase subunit 8 [Vitis vinifera] gi|2099541... 66 9e-09 gb|AKZ24635.1| ATPase subunit 8 (mitochondrion) [Hymenopappus te... 65 2e-08 >gb|AKZ24602.1| ATPase subunit 8 (mitochondrion) [Xanthisma spinulosum] Length = 159 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVLHGQGSIGF 159 >gb|AKZ24598.1| ATPase subunit 8 (mitochondrion) [Heterotheca villosa] Length = 159 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVLHGQGSIGF 159 >gb|AKZ24593.1| ATPase subunit 8 (mitochondrion) [Erigeron bellidiastrum] gi|916445996|gb|AKZ24594.1| ATPase subunit 8 (mitochondrion) [Erigeron strigosus] gi|916445999|gb|AKZ24595.1| ATPase subunit 8 (mitochondrion) [Erigeron philadelphicus] gi|916446005|gb|AKZ24597.1| ATPase subunit 8 (mitochondrion) [Heterotheca stenophylla var. stenophylla] gi|916446016|gb|AKZ24601.1| ATPase subunit 8 (mitochondrion) [Grindelia squarrosa var. squarrosa] gi|916446021|gb|AKZ24603.1| ATPase subunit 8 (mitochondrion) [Solidago missouriensis] gi|916446024|gb|AKZ24604.1| ATPase subunit 8 (mitochondrion) [Gutierrezia sarothrae] Length = 159 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVLHGQGSIGF 159 >ref|YP_005090417.1| atp8 gene product (mitochondrion) [Boea hygrometrica] gi|340549485|gb|AEK53306.1| ATPase subunit 8 (mitochondrion) [Boea hygrometrica] Length = 159 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVLHGQGSIGF 159 >gb|ALF04055.1| ATPase subunit 8 (mitochondrion) [Cannabis sativa] Length = 159 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDI+LIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIILIHVLHGQGSIVF 159 >gb|AKZ24646.1| ATPase subunit 8 (mitochondrion) [Veronica americana] Length = 159 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 159 >gb|AKZ24644.1| ATPase subunit 8, partial (mitochondrion) [Verbascum thapsus] Length = 160 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 159 >gb|AKZ24642.1| ATPase subunit 8 (mitochondrion) [Penstemon angustifolius] gi|916446139|gb|AKZ24643.1| ATPase subunit 8 (mitochondrion) [Penstemon gracilis] Length = 159 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 159 >gb|AKZ24645.1| ATPase subunit 8 (mitochondrion) [Verbena hastata] Length = 159 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 159 >ref|YP_003587373.1| ATPase subunit 8 [Cucurbita pepo] gi|259156804|gb|ACV96665.1| ATPase subunit 8 [Cucurbita pepo] Length = 160 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGI CRNDIMLIHVLHGQGSI F Sbjct: 130 YSTSSNPGWGIACRNDIMLIHVLHGQGSIVF 160 >ref|YP_003587237.1| ATPase subunit 8 [Citrullus lanatus] gi|259156763|gb|ACV96625.1| ATPase subunit 8 [Citrullus lanatus] Length = 159 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGI CRNDIMLIHVLHGQGSI F Sbjct: 129 YSTSSNPGWGIACRNDIMLIHVLHGQGSIVF 159 >gb|AGL75389.1| ATPase subunit 8 (mitochondrion) [Utricularia gibba] Length = 160 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 130 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 160 >emb|CAC29087.1| hypoghetical protein [Olea europaea var. sylvestris] gi|14594885|emb|CAC43435.1| hypothetical protein [Olea europaea] gi|27527162|emb|CAC79246.1| hypothetical protein [Olea europaea subsp. europaea] Length = 159 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIML+HVLHGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLMHVLHGQGSIGF 159 >gb|AHX81462.1| ATPase subunit 8 (mitochondrion) [Licania sprucei] gi|618627365|gb|AHX81481.1| ATPase subunit 8 (mitochondrion) [Hirtella physophora] gi|618627369|gb|AHX81484.1| ATPase subunit 8 (mitochondrion) [Chrysobalanus icaco] gi|618627428|gb|AHX81513.1| ATPase subunit 8 (mitochondrion) [Licania alba] gi|618627451|gb|AHX81525.1| ATPase subunit 8 (mitochondrion) [Licania heteromorpha] gi|618627475|gb|AHX81537.1| ATPase subunit 8 (mitochondrion) [Hirtella racemosa] gi|618627480|gb|AHX81540.1| ATPase subunit 8 (mitochondrion) [Parinari campestris] gi|618627497|gb|AHX81547.1| ATPase subunit 8 (mitochondrion) [Couepia guianensis] Length = 160 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 130 YSTSSNPGWGITCRNDIMLIHVSHGQGSIVF 160 >gb|ALE29222.1| ATPase subunit 8 (mitochondrion) [Heuchera parviflora var. saurensis] gi|927682211|gb|ALE29223.1| ATPase subunit 8 (mitochondrion) [Heuchera parviflora var. saurensis] Length = 159 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVPHGQGSIVF 159 >gb|AKZ24596.1| ATPase subunit 8 (mitochondrion) [Solidago gigantea] Length = 159 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVXHGQGSIGF 159 >gb|AKJ25439.1| ATP synthase F0 subunit 8 (mitochondrion) [Melianthus villosus] Length = 159 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVPHGQGSIVF 159 >ref|YP_009041183.1| ATPase subunit 8 (mitochondrion) [Rhazya stricta] gi|645929307|gb|AIB08830.1| ATPase subunit 8 (mitochondrion) [Rhazya stricta] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 127 YSTSSNPGWGITCRNDIMLIHVPHGQGSIAF 157 >ref|YP_002608379.1| ATPase subunit 8 [Vitis vinifera] gi|209954176|emb|CAQ77628.1| ATPase subunit 8 [Vitis vinifera] gi|239764732|gb|ACS15203.1| ATPase subunit 8 [Vitis vinifera] gi|296088729|emb|CBI38179.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVPHGQGSIVF 159 >gb|AKZ24635.1| ATPase subunit 8 (mitochondrion) [Hymenopappus tenuifolius] Length = 159 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 442 YSTSSNPGWGITCRNDIMLIHVLHGQGSITF 350 YSTSSNPGWGITCRNDIMLIHV HGQGSI F Sbjct: 129 YSTSSNPGWGITCRNDIMLIHVPHGQGSIGF 159