BLASTX nr result
ID: Gardenia21_contig00022780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022780 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16506.1| unnamed protein product [Coffea canephora] 66 1e-08 >emb|CDP16506.1| unnamed protein product [Coffea canephora] Length = 952 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 489 PNLRPSMKEVVKMLIYAEPIAFRSPDNCEKIAKILL 382 PNLRPSM+EVVKMLI AEPI FRSPDNCEK AKILL Sbjct: 917 PNLRPSMREVVKMLIDAEPITFRSPDNCEKNAKILL 952