BLASTX nr result
ID: Gardenia21_contig00022697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022697 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97180.1| unnamed protein product [Coffea canephora] 80 1e-14 >emb|CDO97180.1| unnamed protein product [Coffea canephora] Length = 286 Score = 80.1 bits (196), Expect(2) = 1e-14 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -3 Query: 226 LAKRLKTVVDDTSSEDQIVPSGEFFALGKSIINNKKLGGQAINE 95 LAKRLKTV DDTSSEDQIVPSG+ FALGKSIINNK LGGQAINE Sbjct: 228 LAKRLKTVADDTSSEDQIVPSGKLFALGKSIINNKTLGGQAINE 271 Score = 25.8 bits (55), Expect(2) = 1e-14 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 96 KDFENWSRLNL 64 KDFENWS LNL Sbjct: 275 KDFENWSLLNL 285