BLASTX nr result
ID: Gardenia21_contig00022667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022667 (592 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12103.1| unnamed protein product [Coffea canephora] 64 8e-08 ref|XP_011654711.1| PREDICTED: GDT1-like protein 1, chloroplasti... 60 8e-07 ref|XP_011654710.1| PREDICTED: GDT1-like protein 1, chloroplasti... 60 8e-07 ref|XP_004143960.2| PREDICTED: GDT1-like protein 1, chloroplasti... 60 8e-07 ref|XP_008795076.1| PREDICTED: GDT1-like protein 1, chloroplasti... 60 1e-06 gb|KNA21136.1| hypothetical protein SOVF_046010 isoform B [Spina... 59 1e-06 gb|KNA21135.1| hypothetical protein SOVF_046010 isoform A [Spina... 59 1e-06 ref|XP_011627918.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 ref|XP_011627917.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 ref|XP_011627916.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 ref|XP_010915749.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 ref|XP_010915748.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 ref|XP_010915747.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 1e-06 gb|ERN18140.1| hypothetical protein AMTR_s00054p00088810 [Ambore... 59 1e-06 gb|KHN35056.1| GDT1-like protein 1, chloroplastic [Glycine soja] 59 2e-06 ref|XP_009630286.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 2e-06 ref|XP_010261444.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 2e-06 ref|XP_010261443.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 2e-06 ref|XP_010261442.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 2e-06 ref|XP_009762731.1| PREDICTED: GDT1-like protein 1, chloroplasti... 59 2e-06 >emb|CDP12103.1| unnamed protein product [Coffea canephora] Length = 379 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALGAMT+ISVILGRTFHYVDGILPFR Sbjct: 202 GTFGALGAMTIISVILGRTFHYVDGILPFR 231 >ref|XP_011654711.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X3 [Cucumis sativus] Length = 230 Score = 60.1 bits (144), Expect = 8e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALGAMT+ISV+LGRTFHYVD ILPFR Sbjct: 53 GTFGALGAMTIISVVLGRTFHYVDEILPFR 82 >ref|XP_011654710.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X2 [Cucumis sativus] Length = 253 Score = 60.1 bits (144), Expect = 8e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALGAMT+ISV+LGRTFHYVD ILPFR Sbjct: 76 GTFGALGAMTIISVVLGRTFHYVDEILPFR 105 >ref|XP_004143960.2| PREDICTED: GDT1-like protein 1, chloroplastic isoform X1 [Cucumis sativus] gi|700194865|gb|KGN50042.1| hypothetical protein Csa_5G151580 [Cucumis sativus] Length = 383 Score = 60.1 bits (144), Expect = 8e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALGAMT+ISV+LGRTFHYVD ILPFR Sbjct: 206 GTFGALGAMTIISVVLGRTFHYVDEILPFR 235 >ref|XP_008795076.1| PREDICTED: GDT1-like protein 1, chloroplastic [Phoenix dactylifera] Length = 232 Score = 59.7 bits (143), Expect = 1e-06 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 7/50 (14%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR--SACFPL-----LCCIIEF 464 GTFGAL AM+V+SV+LGRTFHYVDGILPFR FP+ +C ++ F Sbjct: 55 GTFGALAAMSVVSVVLGRTFHYVDGILPFRFGQTDFPIDDFAAVCLLVYF 104 >gb|KNA21136.1| hypothetical protein SOVF_046010 isoform B [Spinacia oleracea] Length = 330 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFRSA 497 GTFGALG MT+ISVILGRTFHY+DG+LPF A Sbjct: 152 GTFGALGIMTIISVILGRTFHYIDGVLPFSFA 183 >gb|KNA21135.1| hypothetical protein SOVF_046010 isoform A [Spinacia oleracea] Length = 312 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFRSA 497 GTFGALG MT+ISVILGRTFHY+DG+LPF A Sbjct: 134 GTFGALGIMTIISVILGRTFHYIDGVLPFSFA 165 >ref|XP_011627918.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X3 [Amborella trichopoda] Length = 385 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AMT+ISV LGRTFHY+DGILPFR Sbjct: 208 GTFGALAAMTIISVFLGRTFHYIDGILPFR 237 >ref|XP_011627917.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X2 [Amborella trichopoda] Length = 393 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AMT+ISV LGRTFHY+DGILPFR Sbjct: 226 GTFGALAAMTIISVFLGRTFHYIDGILPFR 255 >ref|XP_011627916.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X1 [Amborella trichopoda] Length = 403 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AMT+ISV LGRTFHY+DGILPFR Sbjct: 226 GTFGALAAMTIISVFLGRTFHYIDGILPFR 255 >ref|XP_010915749.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X3 [Elaeis guineensis] Length = 331 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AM+V+SV+LGRTFHYVDGILPFR Sbjct: 221 GTFGALAAMSVVSVVLGRTFHYVDGILPFR 250 >ref|XP_010915748.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X2 [Elaeis guineensis] Length = 380 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AM+V+SV+LGRTFHYVDGILPFR Sbjct: 203 GTFGALAAMSVVSVVLGRTFHYVDGILPFR 232 >ref|XP_010915747.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X1 [Elaeis guineensis] Length = 398 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AM+V+SV+LGRTFHYVDGILPFR Sbjct: 221 GTFGALAAMSVVSVVLGRTFHYVDGILPFR 250 >gb|ERN18140.1| hypothetical protein AMTR_s00054p00088810 [Amborella trichopoda] Length = 394 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGAL AMT+ISV LGRTFHY+DGILPFR Sbjct: 208 GTFGALAAMTIISVFLGRTFHYIDGILPFR 237 >gb|KHN35056.1| GDT1-like protein 1, chloroplastic [Glycine soja] Length = 189 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/61 (52%), Positives = 37/61 (60%), Gaps = 8/61 (13%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFRSACFPLLC--------CIIEFDNPGLAIML 437 GTFGAL AMT+ISV+LGRTFHYVD ILPFR L C + +F G I+ Sbjct: 41 GTFGALAAMTLISVVLGRTFHYVDEILPFRCTLGSLPCWMPHPAELAVSDFSGNGAGILS 100 Query: 436 A 434 A Sbjct: 101 A 101 >ref|XP_009630286.1| PREDICTED: GDT1-like protein 1, chloroplastic [Nicotiana tomentosiformis] Length = 362 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALG MT+ISV+LGRTFHYVD ILPFR Sbjct: 185 GTFGALGVMTIISVVLGRTFHYVDDILPFR 214 >ref|XP_010261444.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X3 [Nelumbo nucifera] Length = 300 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GT+GAL AMT+ISV+LGRTFHYVDGILPFR Sbjct: 123 GTYGALVAMTIISVVLGRTFHYVDGILPFR 152 >ref|XP_010261443.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X2 [Nelumbo nucifera] Length = 345 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GT+GAL AMT+ISV+LGRTFHYVDGILPFR Sbjct: 224 GTYGALVAMTIISVVLGRTFHYVDGILPFR 253 >ref|XP_010261442.1| PREDICTED: GDT1-like protein 1, chloroplastic isoform X1 [Nelumbo nucifera] Length = 401 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GT+GAL AMT+ISV+LGRTFHYVDGILPFR Sbjct: 224 GTYGALVAMTIISVVLGRTFHYVDGILPFR 253 >ref|XP_009762731.1| PREDICTED: GDT1-like protein 1, chloroplastic [Nicotiana sylvestris] Length = 361 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 592 GTFGALGAMTVISVILGRTFHYVDGILPFR 503 GTFGALG MT+ISV+LGRTFHYVD +LPFR Sbjct: 184 GTFGALGVMTIISVVLGRTFHYVDDVLPFR 213