BLASTX nr result
ID: Gardenia21_contig00022511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022511 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10908.1| unnamed protein product [Coffea canephora] 191 1e-46 emb|CDP02910.1| unnamed protein product [Coffea canephora] 89 2e-15 emb|CDP16120.1| unnamed protein product [Coffea canephora] 86 1e-14 ref|XP_011097323.1| PREDICTED: F-box protein At3g07870-like [Ses... 67 5e-09 ref|XP_007221317.1| hypothetical protein PRUPE_ppa020265mg [Prun... 66 1e-08 ref|XP_012854741.1| PREDICTED: F-box protein At3g07870-like [Ery... 65 3e-08 ref|XP_011097312.1| PREDICTED: F-box protein At3g07870-like [Ses... 64 3e-08 ref|XP_012854961.1| PREDICTED: F-box protein At3g07870-like [Ery... 64 4e-08 gb|EYU22872.1| hypothetical protein MIMGU_mgv1a026910mg [Erythra... 64 4e-08 ref|XP_004298217.1| PREDICTED: putative F-box protein At3g16210 ... 64 6e-08 ref|XP_009796943.1| PREDICTED: F-box protein CPR30-like [Nicotia... 62 2e-07 ref|XP_003612244.2| F-box protein interaction domain protein [Me... 62 2e-07 ref|XP_003612169.2| F-box protein interaction domain protein [Me... 62 2e-07 ref|XP_012855065.1| PREDICTED: F-box/kelch-repeat protein At3g23... 60 5e-07 gb|EYU22881.1| hypothetical protein MIMGU_mgv1a002886mg [Erythra... 60 5e-07 ref|XP_003595512.1| F-box protein interaction domain protein [Me... 60 5e-07 ref|XP_008223139.1| PREDICTED: uncharacterized protein LOC103322... 60 6e-07 ref|XP_009373591.1| PREDICTED: F-box protein At3g07870-like isof... 60 8e-07 ref|XP_009373590.1| PREDICTED: F-box protein At3g07870-like isof... 60 8e-07 ref|XP_009373589.1| PREDICTED: F-box protein At3g07870-like isof... 60 8e-07 >emb|CDP10908.1| unnamed protein product [Coffea canephora] Length = 412 Score = 191 bits (486), Expect = 1e-46 Identities = 93/109 (85%), Positives = 99/109 (90%), Gaps = 1/109 (0%) Frame = -3 Query: 326 CRSSHNNE-DYRMVQVNGDDNMLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEP 150 CRSSHN + DY+MVQVN +DNMLLNLPSHI IDILSRLSTKTL RCRCVCK+W+KLLSEP Sbjct: 6 CRSSHNKKKDYKMVQVNDEDNMLLNLPSHIIIDILSRLSTKTLSRCRCVCKVWQKLLSEP 65 Query: 149 EFSRFRILRPPTTSLMIHKTSDSSFNLVEFEDEANYHDFYYVLGTKFEQ 3 EFS FRILRPPTTSLMIHK SDSSFNL+EFEDE NYHDFY V GTKFEQ Sbjct: 66 EFSSFRILRPPTTSLMIHKNSDSSFNLLEFEDEPNYHDFYCVPGTKFEQ 114 >emb|CDP02910.1| unnamed protein product [Coffea canephora] Length = 399 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 4/89 (4%) Frame = -3 Query: 260 LNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPP----TTSLMIHK 93 LNLP+H+ DILSRL KT+ +C+ VCK W LLSE EF+ +LR P +L H Sbjct: 8 LNLPAHVVSDILSRLPPKTIIQCKAVCKSWLSLLSESEFTNLHLLRSPPCLIINNLDYHP 67 Query: 92 TSDSSFNLVEFEDEANYHDFYYVLGTKFE 6 + + F+LVEFED+ ++HDF +V GTK + Sbjct: 68 SDLNCFSLVEFEDQPDHHDFQHVAGTKIK 96 >emb|CDP16120.1| unnamed protein product [Coffea canephora] Length = 430 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 4/86 (4%) Frame = -3 Query: 260 LNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLM----IHK 93 LNLPSH+ DILSRL TKT+ +C+ VCK W LLSE EF++ + R P ++ H Sbjct: 34 LNLPSHLINDILSRLPTKTIIQCKSVCKSWLSLLSESEFTKLHLQRSPPCLIINKFGCHP 93 Query: 92 TSDSSFNLVEFEDEANYHDFYYVLGT 15 + + F LVEFEDE ++H F YV GT Sbjct: 94 SELTCFGLVEFEDEPDHHGFRYVAGT 119 >ref|XP_011097323.1| PREDICTED: F-box protein At3g07870-like [Sesamum indicum] Length = 389 Score = 67.0 bits (162), Expect = 5e-09 Identities = 38/93 (40%), Positives = 52/93 (55%), Gaps = 5/93 (5%) Frame = -3 Query: 275 DDNMLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILR--PPTTSLM 102 + + NLP+ + I+ILSRL +T+ C+CVCK W LL PEF+R + R P Sbjct: 2 NQELFTNLPAELIINILSRLPIRTIISCKCVCKSWLNLLDTPEFARSHLSRSVPGLILWQ 61 Query: 101 IHKTSDSS-FNLVEFEDEANY--HDFYYVLGTK 12 H+ DS F + EFEDE + HD +Y TK Sbjct: 62 RHRDLDSEHFEIFEFEDELDLERHDLHYNPVTK 94 >ref|XP_007221317.1| hypothetical protein PRUPE_ppa020265mg [Prunus persica] gi|462417951|gb|EMJ22516.1| hypothetical protein PRUPE_ppa020265mg [Prunus persica] Length = 325 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/80 (36%), Positives = 51/80 (63%), Gaps = 4/80 (5%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTS- 87 +L LP+H++++I ++ KTL +CRCVCK WR LS+PEF+++ PT L+ + +S Sbjct: 5 ILQLPNHLTVEIFCKIPIKTLIQCRCVCKSWRCSLSDPEFTKYLFSETPTCLLLQNSSSR 64 Query: 86 ---DSSFNLVEFEDEANYHD 36 S L++ ++ +N +D Sbjct: 65 NPNSSGLFLIDLDNASNRND 84 >ref|XP_012854741.1| PREDICTED: F-box protein At3g07870-like [Erythranthe guttatus] gi|604303401|gb|EYU22874.1| hypothetical protein MIMGU_mgv1a007673mg [Erythranthe guttata] Length = 399 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -3 Query: 257 NLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTSDSS 78 NLP I+IDILSRL + + C+CVC WR+LL EF F + + L+ H + Sbjct: 17 NLPLEITIDILSRLPIRRIAICKCVCNSWRELLRSREFLDFHLSKSVPGLLIGHDWDPEN 76 Query: 77 FNLVEFEDEANY--HDFYYVLGTKF 9 + + EF DE HD +Y TKF Sbjct: 77 YRIFEFVDELGLETHDLHYNTVTKF 101 >ref|XP_011097312.1| PREDICTED: F-box protein At3g07870-like [Sesamum indicum] Length = 416 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/87 (37%), Positives = 52/87 (59%), Gaps = 2/87 (2%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTS- 87 L+NLP+HI ++IL+RL KT+ C+ VCK W +L+++P F+ R L++H + Sbjct: 40 LMNLPTHIMLEILTRLPPKTIFICKRVCKAWLELINDPHFATLHFSR-CRAGLVVHHSEM 98 Query: 86 -DSSFNLVEFEDEANYHDFYYVLGTKF 9 F LV+FED ++HD + KF Sbjct: 99 FKKYFKLVDFEDAYDHHDLPHDTMLKF 125 >ref|XP_012854961.1| PREDICTED: F-box protein At3g07870-like [Erythranthe guttatus] Length = 388 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 2/78 (2%) Frame = -3 Query: 266 MLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTS 87 +++NLP HI I+IL+RL K + +C+ VCK W +L++EP F+ F SL++H+T Sbjct: 9 LIINLPPHIIIEILARLPPKKIIQCKSVCKKWLELINEPYFASFHFTL-SIPSLVVHQTE 67 Query: 86 --DSSFNLVEFEDEANYH 39 + F +V F+D+ ++H Sbjct: 68 TFKNFFKIVHFDDKYDHH 85 >gb|EYU22872.1| hypothetical protein MIMGU_mgv1a026910mg [Erythranthe guttata] Length = 368 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 2/78 (2%) Frame = -3 Query: 266 MLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTS 87 +++NLP HI I+IL+RL K + +C+ VCK W +L++EP F+ F SL++H+T Sbjct: 9 LIINLPPHIIIEILARLPPKKIIQCKSVCKKWLELINEPYFASFHFTL-SIPSLVVHQTE 67 Query: 86 --DSSFNLVEFEDEANYH 39 + F +V F+D+ ++H Sbjct: 68 TFKNFFKIVHFDDKYDHH 85 >ref|XP_004298217.1| PREDICTED: putative F-box protein At3g16210 [Fragaria vesca subsp. vesca] Length = 209 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 2/89 (2%) Frame = -3 Query: 272 DNMLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHK 93 ++ +L LP+ + ++ ++ TK L +C+CVCK WR+LLS+P F++ + R PT L+ Sbjct: 29 EHHILKLPNRVVLEFFCKIPTKWLAQCKCVCKSWRRLLSDPHFTKALLARTPTYLLLRDT 88 Query: 92 TSDSSFNLVEFEDEAN--YHDFYYVLGTK 12 S + +FE +N DFY V T+ Sbjct: 89 CYVKSLVIFDFEKASNRKMSDFYDVPKTQ 117 >ref|XP_009796943.1| PREDICTED: F-box protein CPR30-like [Nicotiana sylvestris] Length = 390 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/86 (39%), Positives = 46/86 (53%), Gaps = 7/86 (8%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPP-------TTSL 105 +LNLP I +ILS LS KT+ CR VCK W L+S PEFS+ + + P + S Sbjct: 8 ILNLPLSILENILSNLSPKTVFICRSVCKSWLNLISLPEFSKLHLSKSPDNLFIYFSQSS 67 Query: 104 MIHKTSDSSFNLVEFEDEANYHDFYY 27 S S F + F+D +YH+ Y Sbjct: 68 WSELPSTSVFKFINFDDTPHYHNLIY 93 >ref|XP_003612244.2| F-box protein interaction domain protein [Medicago truncatula] gi|657384216|gb|AES95202.2| F-box protein interaction domain protein [Medicago truncatula] Length = 482 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -3 Query: 257 NLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTSD 84 NLPSH++ +IL RL K L C+CVCK+W++L+SEP F++ + R P S MI D Sbjct: 31 NLPSHLTANILLRLPVKPLLICKCVCKIWKRLISEPHFAKLQFERAP-LSFMIRTLDD 87 >ref|XP_003612169.2| F-box protein interaction domain protein [Medicago truncatula] gi|657384191|gb|AES95127.2| F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/58 (51%), Positives = 43/58 (74%) Frame = -3 Query: 257 NLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTSD 84 NLPSHI+ IL +LS K+L C+CVCK+W+ ++SEP F++ + R P SLMI +T+D Sbjct: 39 NLPSHITTQILLQLSIKSLLICKCVCKIWKTMISEPHFAKLQFERAP-LSLMI-RTND 94 >ref|XP_012855065.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Erythranthe guttatus] Length = 394 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 4/86 (4%) Frame = -3 Query: 254 LPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTSDSSF 75 +P I IDILSRL +T+ C+CVC WR LL EF+ + + + K + Sbjct: 18 IPPEIVIDILSRLPIRTIAECKCVCNSWRDLLQTAEFAHTHLSKSVAGLIFGFKWDFRNL 77 Query: 74 NLVEFEDEANY----HDFYYVLGTKF 9 ++EF DE HD +Y L TKF Sbjct: 78 KILEFVDELGLDFESHDLHYSLLTKF 103 >gb|EYU22881.1| hypothetical protein MIMGU_mgv1a002886mg [Erythranthe guttata] Length = 628 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 4/86 (4%) Frame = -3 Query: 254 LPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLMIHKTSDSSF 75 +P I IDILSRL +T+ C+CVC WR LL EF+ + + + K + Sbjct: 252 IPPEIVIDILSRLPIRTIAECKCVCNSWRDLLQTAEFAHTHLSKSVAGLIFGFKWDFRNL 311 Query: 74 NLVEFEDEANY----HDFYYVLGTKF 9 ++EF DE HD +Y L TKF Sbjct: 312 KILEFVDELGLDFESHDLHYSLLTKF 337 >ref|XP_003595512.1| F-box protein interaction domain protein [Medicago truncatula] gi|355484560|gb|AES65763.1| F-box protein interaction domain protein [Medicago truncatula] Length = 342 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -3 Query: 272 DNMLLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEF--SRFRILRPPTTSLMI 99 + M + LP + +IL RL KTL RCRCVCKLW ++S P F S F++ PT +M+ Sbjct: 2 EKMSVYLPEEVIKEILLRLPVKTLLRCRCVCKLWLSIISHPHFSTSHFQLAASPTHKIMV 61 Query: 98 HKTSDS 81 K + + Sbjct: 62 FKAASA 67 >ref|XP_008223139.1| PREDICTED: uncharacterized protein LOC103322958 [Prunus mume] Length = 804 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 7/75 (9%) Frame = -3 Query: 260 LNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLM------- 102 L LP I +DILSRLS KTL CRCVCK W ++S+P+F+ R P L+ Sbjct: 418 LQLPQAIVMDILSRLSVKTLFNCRCVCKAWLSMISDPQFTHLHASRSPFGILIETFPPPP 477 Query: 101 IHKTSDSSFNLVEFE 57 + K + F L+E E Sbjct: 478 LTKPMELYFTLLEVE 492 >ref|XP_009373591.1| PREDICTED: F-box protein At3g07870-like isoform X3 [Pyrus x bretschneideri] Length = 399 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/54 (40%), Positives = 39/54 (72%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLM 102 +L LP+HI+++I ++ K L +CRCVCK WR+ LS+P+F+++ + + P L+ Sbjct: 41 ILQLPNHITVEIFGKIPIKALIQCRCVCKPWRRSLSDPQFTKYLLSQTPDCLLL 94 >ref|XP_009373590.1| PREDICTED: F-box protein At3g07870-like isoform X2 [Pyrus x bretschneideri] Length = 429 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/54 (40%), Positives = 39/54 (72%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLM 102 +L LP+HI+++I ++ K L +CRCVCK WR+ LS+P+F+++ + + P L+ Sbjct: 41 ILQLPNHITVEIFGKIPIKALIQCRCVCKPWRRSLSDPQFTKYLLSQTPDCLLL 94 >ref|XP_009373589.1| PREDICTED: F-box protein At3g07870-like isoform X1 [Pyrus x bretschneideri] Length = 454 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/54 (40%), Positives = 39/54 (72%) Frame = -3 Query: 263 LLNLPSHISIDILSRLSTKTLCRCRCVCKLWRKLLSEPEFSRFRILRPPTTSLM 102 +L LP+HI+++I ++ K L +CRCVCK WR+ LS+P+F+++ + + P L+ Sbjct: 41 ILQLPNHITVEIFGKIPIKALIQCRCVCKPWRRSLSDPQFTKYLLSQTPDCLLL 94