BLASTX nr result
ID: Gardenia21_contig00022170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00022170 (247 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00023.1| unnamed protein product [Coffea canephora] 103 5e-20 >emb|CDP00023.1| unnamed protein product [Coffea canephora] Length = 182 Score = 103 bits (257), Expect = 5e-20 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = -3 Query: 173 MVRIHVKHSCRQHVNGAAGELEFLYDCEASSTIQHITQDITEIANFQLQIQQLGSQL 3 MVRIHVKH CR+ VNGA GELEFLYDCE SSTIQHITQDITEIANFQLQI+QLG QL Sbjct: 1 MVRIHVKHGCRRAVNGADGELEFLYDCETSSTIQHITQDITEIANFQLQIRQLGCQL 57