BLASTX nr result
ID: Gardenia21_contig00021966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00021966 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16634.1| unnamed protein product [Coffea canephora] 112 1e-22 >emb|CDP16634.1| unnamed protein product [Coffea canephora] Length = 772 Score = 112 bits (279), Expect = 1e-22 Identities = 55/71 (77%), Positives = 57/71 (80%) Frame = +3 Query: 3 ASLSHIGAGLRGIRNRTSCFKGQNWDLRCKLFCNYSTRLLRDPKRGSFGASFALNFVLEE 182 ASLSHI GL GI +RT CFK QNWD R KLFCNYSTRLL DPKRGS GASFALN VLEE Sbjct: 43 ASLSHIRVGLTGIGSRTCCFKCQNWDSRSKLFCNYSTRLLCDPKRGSLGASFALNLVLEE 102 Query: 183 EAAENHVRNDE 215 +A NHVR DE Sbjct: 103 QATGNHVRKDE 113