BLASTX nr result
ID: Gardenia21_contig00021561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00021561 (210 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05949.1| unnamed protein product [Coffea canephora] 127 2e-27 ref|XP_007021561.1| Tetratricopeptide repeat (TPR)-like superfam... 101 2e-19 ref|XP_011082707.1| PREDICTED: putative pentatricopeptide repeat... 100 6e-19 ref|XP_009776699.1| PREDICTED: putative pentatricopeptide repeat... 99 2e-18 ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat... 98 3e-18 ref|XP_008447751.1| PREDICTED: putative pentatricopeptide repeat... 97 4e-18 ref|XP_009592364.1| PREDICTED: putative pentatricopeptide repeat... 97 6e-18 ref|XP_010060619.1| PREDICTED: putative pentatricopeptide repeat... 96 8e-18 ref|XP_012847880.1| PREDICTED: putative pentatricopeptide repeat... 96 1e-17 gb|EYU44970.1| hypothetical protein MIMGU_mgv1a007373mg [Erythra... 96 1e-17 ref|XP_009340662.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 ref|XP_008350003.1| PREDICTED: putative pentatricopeptide repeat... 93 9e-17 ref|XP_008355394.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 92 1e-16 ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 gb|KDO49242.1| hypothetical protein CISIN_1g048749mg [Citrus sin... 92 2e-16 ref|XP_006464901.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_006451781.1| hypothetical protein CICLE_v10007960mg [Citr... 92 2e-16 ref|XP_007211489.1| hypothetical protein PRUPE_ppa007680mg [Prun... 91 3e-16 ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat... 91 4e-16 ref|XP_008226555.1| PREDICTED: putative pentatricopeptide repeat... 90 6e-16 >emb|CDP05949.1| unnamed protein product [Coffea canephora] Length = 531 Score = 127 bits (320), Expect = 2e-27 Identities = 61/69 (88%), Positives = 61/69 (88%) Frame = -1 Query: 207 CILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGL 28 CILERMERRGCKLDGDIYNLLLRLFM WGI E Q WNDME SGMGPDKRSYTIMIHGL Sbjct: 414 CILERMERRGCKLDGDIYNLLLRLFMGWGIQESAQSFWNDMERSGMGPDKRSYTIMIHGL 473 Query: 27 FGKGMMKES 1 F KGMMKES Sbjct: 474 FEKGMMKES 482 >ref|XP_007021561.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508721189|gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 534 Score = 101 bits (252), Expect = 2e-19 Identities = 43/68 (63%), Positives = 58/68 (85%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERMER GC + GD YNL+L+L+MKWG ERV+ TW++ME SG+GPD+RSYTIMIHGL+ Sbjct: 406 VLERMERYGCNMSGDTYNLILKLYMKWGHEERVRCTWDEMEKSGLGPDRRSYTIMIHGLY 465 Query: 24 GKGMMKES 1 KG ++++ Sbjct: 466 DKGSIEDA 473 >ref|XP_011082707.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Sesamum indicum] Length = 523 Score = 100 bits (248), Expect = 6e-19 Identities = 44/68 (64%), Positives = 57/68 (83%) Frame = -1 Query: 210 DCILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHG 31 D ILERME+ GCKL D YNL+LRLFM+WG R+++TWN+ME SG+GPD+RSYTI+IHG Sbjct: 404 DGILERMEKSGCKLQADTYNLVLRLFMEWGDEGRLKYTWNEMERSGLGPDQRSYTIIIHG 463 Query: 30 LFGKGMMK 7 L+ KG ++ Sbjct: 464 LYDKGKIE 471 >ref|XP_009776699.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Nicotiana sylvestris] Length = 505 Score = 98.6 bits (244), Expect = 2e-18 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 ILERM + GCK+ GD YNLLLRLFM W ERV+ TW++ME SG+GPD+RSYTIMIHGLF Sbjct: 386 ILERMNKNGCKMLGDTYNLLLRLFMSWDNQERVKSTWDEMEKSGLGPDQRSYTIMIHGLF 445 Query: 24 GKGMMKES 1 +G ++++ Sbjct: 446 ERGRLEDA 453 >ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Cucumis sativus] gi|778725607|ref|XP_011658966.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Cucumis sativus] gi|778725610|ref|XP_011658967.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Cucumis sativus] gi|700188915|gb|KGN44148.1| hypothetical protein Csa_7G206990 [Cucumis sativus] Length = 532 Score = 97.8 bits (242), Expect = 3e-18 Identities = 42/67 (62%), Positives = 54/67 (80%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 + +RMER GCK+ DIYNL+LRL+M W I ERV+ TWN+M+ G+GPD+RSYTIMIHGL+ Sbjct: 426 LFQRMERSGCKMTSDIYNLILRLYMDWDIQERVKSTWNEMKEMGLGPDRRSYTIMIHGLY 485 Query: 24 GKGMMKE 4 KG K+ Sbjct: 486 EKGRTKD 492 >ref|XP_008447751.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Cucumis melo] gi|659093852|ref|XP_008447752.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Cucumis melo] Length = 535 Score = 97.4 bits (241), Expect = 4e-18 Identities = 42/67 (62%), Positives = 54/67 (80%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +L+RME GCK+ DIYNL+LRL+M W I ERV+ TWN+M+ G+GPD+RSYTIMIHGL+ Sbjct: 426 LLQRMETSGCKMTSDIYNLILRLYMDWNIQERVKSTWNEMKEMGLGPDRRSYTIMIHGLY 485 Query: 24 GKGMMKE 4 KG K+ Sbjct: 486 EKGRTKD 492 >ref|XP_009592364.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Nicotiana tomentosiformis] Length = 506 Score = 96.7 bits (239), Expect = 6e-18 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 ILERM + GCK+ GD YNLLLRLFM W ERV TW++ME SG+GPD+RSYTIMIHGLF Sbjct: 387 ILERMNKNGCKMLGDTYNLLLRLFMSWDNQERVMSTWDEMERSGLGPDQRSYTIMIHGLF 446 Query: 24 GKGMMKES 1 G ++++ Sbjct: 447 EGGRLEDA 454 >ref|XP_010060619.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Eucalyptus grandis] gi|629101930|gb|KCW67399.1| hypothetical protein EUGRSUZ_F01165 [Eucalyptus grandis] Length = 526 Score = 96.3 bits (238), Expect = 8e-18 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LE+ME+ GCK+ D+YNL+LRL++ W ERV TWNDMEISG+GPD+RSYTIMIH L Sbjct: 396 LLEQMEKNGCKMTSDLYNLVLRLYLGWDCQERVGNTWNDMEISGLGPDQRSYTIMIHTLH 455 Query: 24 GKGMMKES 1 +G +KE+ Sbjct: 456 ERGRLKEA 463 >ref|XP_012847880.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Erythranthe guttatus] Length = 536 Score = 95.9 bits (237), Expect = 1e-17 Identities = 40/65 (61%), Positives = 55/65 (84%) Frame = -1 Query: 210 DCILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHG 31 D ILERM+++GCKL+ D YNL LRLF +WG ERV++ W++ME +G+GPD+RSYTI++HG Sbjct: 414 DTILERMKKKGCKLEADTYNLALRLFTEWGDEERVKYFWDEMERNGLGPDRRSYTIIVHG 473 Query: 30 LFGKG 16 L+ KG Sbjct: 474 LYDKG 478 >gb|EYU44970.1| hypothetical protein MIMGU_mgv1a007373mg [Erythranthe guttata] Length = 409 Score = 95.9 bits (237), Expect = 1e-17 Identities = 40/65 (61%), Positives = 55/65 (84%) Frame = -1 Query: 210 DCILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHG 31 D ILERM+++GCKL+ D YNL LRLF +WG ERV++ W++ME +G+GPD+RSYTI++HG Sbjct: 295 DTILERMKKKGCKLEADTYNLALRLFTEWGDEERVKYFWDEMERNGLGPDRRSYTIIVHG 354 Query: 30 LFGKG 16 L+ KG Sbjct: 355 LYDKG 359 >ref|XP_009340662.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Pyrus x bretschneideri] Length = 554 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/68 (57%), Positives = 56/68 (82%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LER+++ GCK+ GD YNLLL+L+M+W ERV++TW++ME +G+GPD+RSYTIMIHG Sbjct: 433 LLERLQKNGCKMTGDTYNLLLKLYMEWDCQERVRYTWDEMEKNGLGPDRRSYTIMIHGFH 492 Query: 24 GKGMMKES 1 K +KE+ Sbjct: 493 DKRRIKET 500 >ref|XP_008350003.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Malus domestica] gi|658029122|ref|XP_008350004.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Malus domestica] Length = 554 Score = 92.8 bits (229), Expect = 9e-17 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERM+R CK+ GD YNLLL+L+M+W ERV++TW++ME +G+GPD+RSYTI+IHG Sbjct: 433 LLERMQRNQCKMTGDTYNLLLKLYMEWDCQERVRYTWDEMEKNGLGPDRRSYTIIIHGFH 492 Query: 24 GKGMMKES 1 K +KE+ Sbjct: 493 DKRRIKET 500 >ref|XP_008355394.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15200 [Malus domestica] Length = 379 Score = 92.4 bits (228), Expect = 1e-16 Identities = 39/68 (57%), Positives = 53/68 (77%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERM++ GC L GD YNLLL+L+M+W ERV++ W++ME G+GPD+RSYTIMIHG Sbjct: 257 LLERMQKNGCNLTGDTYNLLLKLYMEWDCQERVRYKWDEMEKKGLGPDRRSYTIMIHGFH 316 Query: 24 GKGMMKES 1 K +KE+ Sbjct: 317 DKRRVKET 324 >ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200 [Solanum lycopersicum] Length = 488 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/68 (60%), Positives = 54/68 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 ILERM CK+ GDIYNLLLRLFM W ++V+ TW++ME SG+GPD+RSYTIMIHGL+ Sbjct: 370 ILERMNGNQCKMTGDIYNLLLRLFMSWDDQDKVKSTWDEMERSGLGPDQRSYTIMIHGLY 429 Query: 24 GKGMMKES 1 G ++++ Sbjct: 430 EGGRLEDA 437 >gb|KDO49242.1| hypothetical protein CISIN_1g048749mg [Citrus sinensis] Length = 536 Score = 91.7 bits (226), Expect = 2e-16 Identities = 36/68 (52%), Positives = 54/68 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERMER GCK+ D YN++L+L++ W ++V+ TW +ME GMGPD+RSYT+MIHGL+ Sbjct: 418 VLERMERNGCKMSTDTYNVILKLYVNWDCEDKVRHTWEEMEKKGMGPDQRSYTVMIHGLY 477 Query: 24 GKGMMKES 1 KG ++++ Sbjct: 478 DKGRLEDA 485 >ref|XP_006464901.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Citrus sinensis] Length = 536 Score = 91.7 bits (226), Expect = 2e-16 Identities = 36/68 (52%), Positives = 54/68 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERMER GCK+ D YN++L+L++ W ++V+ TW +ME GMGPD+RSYT+MIHGL+ Sbjct: 418 VLERMERNGCKMSTDTYNVILKLYVNWDCEDKVRHTWEEMEKKGMGPDQRSYTVMIHGLY 477 Query: 24 GKGMMKES 1 KG ++++ Sbjct: 478 DKGRLEDA 485 >ref|XP_006451781.1| hypothetical protein CICLE_v10007960mg [Citrus clementina] gi|557555007|gb|ESR65021.1| hypothetical protein CICLE_v10007960mg [Citrus clementina] Length = 536 Score = 91.7 bits (226), Expect = 2e-16 Identities = 36/68 (52%), Positives = 54/68 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERMER GCK+ D YN++L+L++ W ++V+ TW +ME GMGPD+RSYT+MIHGL+ Sbjct: 418 VLERMERNGCKMSTDTYNVILKLYVNWDCEDKVRHTWEEMEKKGMGPDQRSYTVMIHGLY 477 Query: 24 GKGMMKES 1 KG ++++ Sbjct: 478 DKGRLEDA 485 >ref|XP_007211489.1| hypothetical protein PRUPE_ppa007680mg [Prunus persica] gi|462407354|gb|EMJ12688.1| hypothetical protein PRUPE_ppa007680mg [Prunus persica] Length = 359 Score = 90.9 bits (224), Expect = 3e-16 Identities = 38/67 (56%), Positives = 53/67 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERME+ CK+ D YNLLL+L+M+W ER+++TW +ME +G+GPD+RSYTIMIHG Sbjct: 253 LLERMEKSRCKMTSDTYNLLLKLYMEWDCEERLRYTWEEMERNGLGPDQRSYTIMIHGFH 312 Query: 24 GKGMMKE 4 KG +K+ Sbjct: 313 DKGRIKD 319 >ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Solanum tuberosum] Length = 489 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/68 (58%), Positives = 53/68 (77%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 ILERM CK+ GDIYNLLLRLFM W ++V+ W++ME SG+GPD+RSYTIMIHGL+ Sbjct: 371 ILERMNENQCKMTGDIYNLLLRLFMSWDNQDKVKSMWDEMERSGLGPDQRSYTIMIHGLY 430 Query: 24 GKGMMKES 1 G ++++ Sbjct: 431 EGGRLEDA 438 >ref|XP_008226555.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200, partial [Prunus mume] Length = 534 Score = 90.1 bits (222), Expect = 6e-16 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = -1 Query: 204 ILERMERRGCKLDGDIYNLLLRLFMKWGILERVQFTWNDMEISGMGPDKRSYTIMIHGLF 25 +LERME+ CK+ D YNL+L+L+M+W ER+++TW +ME +G+GPD+RSYTIMIHG Sbjct: 413 LLERMEKSRCKMTSDTYNLMLKLYMEWDCEERLRYTWEEMERNGLGPDQRSYTIMIHGFH 472 Query: 24 GKGMMKE 4 KG +K+ Sbjct: 473 DKGRIKD 479