BLASTX nr result
ID: Gardenia21_contig00020951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00020951 (582 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09335.1| unnamed protein product [Coffea canephora] 81 2e-16 >emb|CDP09335.1| unnamed protein product [Coffea canephora] Length = 372 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 43/62 (69%), Positives = 50/62 (80%), Gaps = 1/62 (1%) Frame = -2 Query: 260 GDLENDKYLEQLFEVESRMS*NAFRINQSDVMVMLKL-VFVLDVYRTGRLDHHILDAIPR 84 GDLENDKYLEQL EVESRM NAFRI QS+V K+ + +LD+YRTGRL H++LD IPR Sbjct: 311 GDLENDKYLEQLIEVESRMLRNAFRITQSEVDGHTKVAIKLLDLYRTGRLGHYVLDDIPR 370 Query: 83 IS 78 IS Sbjct: 371 IS 372 Score = 31.6 bits (70), Expect(2) = 2e-16 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 319 QDFTVNDVQRTLFEAV 272 QDF VNDV+RTLFEAV Sbjct: 291 QDFIVNDVRRTLFEAV 306