BLASTX nr result
ID: Gardenia21_contig00020585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00020585 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO96725.1| unnamed protein product [Coffea canephora] 63 1e-09 >emb|CDO96725.1| unnamed protein product [Coffea canephora] Length = 500 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 186 NRRKGGRVGMEENTLAILDTSSSASFHHLLDDQ 88 NR +GGRVG+EENTLAILDTSSSASFHHLLDD+ Sbjct: 32 NRGRGGRVGLEENTLAILDTSSSASFHHLLDDR 64 Score = 26.2 bits (56), Expect(2) = 1e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 88 KMFEAVFQVLKDE 50 KMF AVFQ+LKDE Sbjct: 87 KMFVAVFQILKDE 99