BLASTX nr result
ID: Gardenia21_contig00020569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00020569 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHW58028.1| TM3-2 [Coffea arabica] 64 6e-08 emb|CDP17592.1| unnamed protein product [Coffea canephora] 63 1e-07 >gb|AHW58028.1| TM3-2 [Coffea arabica] Length = 212 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 222 EKINLQYEGQRLELSINRQPLPVRQAKEVETQLFIGLPEN*NCP 91 EK+NLQYE QRL SI+RQPL +RQ KE+ET+LFIGLPE+ N P Sbjct: 169 EKMNLQYEQQRLGPSISRQPLSLRQVKEIETRLFIGLPESSNYP 212 >emb|CDP17592.1| unnamed protein product [Coffea canephora] Length = 212 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 222 EKINLQYEGQRLELSINRQPLPVRQAKEVETQLFIGLPEN*NCP 91 EK++LQYE QRL SI+RQPL +RQ KE+ET+LFIGLPE+ N P Sbjct: 169 EKVHLQYEQQRLGQSISRQPLSLRQVKEIETRLFIGLPESSNYP 212