BLASTX nr result
ID: Gardenia21_contig00019820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00019820 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09326.1| unnamed protein product [Coffea canephora] 98 3e-18 >emb|CDP09326.1| unnamed protein product [Coffea canephora] Length = 89 Score = 97.8 bits (242), Expect = 3e-18 Identities = 49/55 (89%), Positives = 50/55 (90%), Gaps = 1/55 (1%) Frame = -3 Query: 162 MCKAIDENVLKDDFLVDD-GLQSDEHHSNFHDQEYIGKIKELQFYLDTVEKVVKP 1 M KA+ ENVLKDDFLVDD GLQS EHH NFHDQEYIGKIKELQFYLDTVEKVVKP Sbjct: 1 MWKAVHENVLKDDFLVDDEGLQSYEHHLNFHDQEYIGKIKELQFYLDTVEKVVKP 55