BLASTX nr result
ID: Gardenia21_contig00019507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00019507 (414 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08826.1| unnamed protein product [Coffea canephora] 76 1e-11 >emb|CDP08826.1| unnamed protein product [Coffea canephora] Length = 428 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 106 MYVQTLPISKCAFHPINLSPGTHLLTHCTQTSQIR 2 MYVQTLPISKCAFHPINLSPGTHLLTHCTQT QIR Sbjct: 1 MYVQTLPISKCAFHPINLSPGTHLLTHCTQTIQIR 35