BLASTX nr result
ID: Gardenia21_contig00017953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017953 (219 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11028.1| unnamed protein product [Coffea canephora] 68 3e-09 >emb|CDP11028.1| unnamed protein product [Coffea canephora] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 104 MSSSIHLFSVNPINFRHSRYSISQNRQLLSPLAC 3 MSSSIHLFS+NP++FRHSRYSISQNRQ+LSPLAC Sbjct: 1 MSSSIHLFSINPVDFRHSRYSISQNRQVLSPLAC 34