BLASTX nr result
ID: Gardenia21_contig00017843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017843 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008443158.1| PREDICTED: ribosome production factor 1 isof... 61 4e-07 ref|XP_008443155.1| PREDICTED: ribosome production factor 1 isof... 61 4e-07 ref|XP_002515122.1| U3 small nucleolar ribonucleoprotein protein... 61 4e-07 ref|XP_011652142.1| PREDICTED: ribosome production factor 1 [Cuc... 61 4e-07 gb|KDO86670.1| hypothetical protein CISIN_1g016414mg [Citrus sin... 59 1e-06 emb|CDP06320.1| unnamed protein product [Coffea canephora] 59 2e-06 emb|CDP18631.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_007051371.1| Ribosomal RNA processing Brix domain protein... 59 2e-06 ref|XP_007051370.1| Ribosomal RNA processing Brix domain protein... 59 2e-06 ref|XP_007051369.1| Ribosomal RNA processing Brix domain protein... 59 2e-06 ref|XP_009414941.1| PREDICTED: ribosome production factor 1-like... 58 2e-06 gb|EPS61568.1| hypothetical protein M569_13224 [Genlisea aurea] 58 2e-06 ref|XP_011077098.1| PREDICTED: ribosome production factor 1 [Ses... 58 3e-06 ref|XP_010940990.1| PREDICTED: ribosome production factor 1 isof... 58 3e-06 ref|XP_010940989.1| PREDICTED: ribosome production factor 1 isof... 58 3e-06 ref|XP_010054928.1| PREDICTED: ribosome production factor 1 [Euc... 57 4e-06 ref|XP_010542822.1| PREDICTED: ribosome production factor 1-like... 57 5e-06 ref|XP_004307320.1| PREDICTED: ribosome production factor 1 [Fra... 57 5e-06 ref|XP_010242770.1| PREDICTED: ribosome production factor 1-like... 57 7e-06 ref|XP_009376048.1| PREDICTED: ribosome production factor 1-like... 57 7e-06 >ref|XP_008443158.1| PREDICTED: ribosome production factor 1 isoform X2 [Cucumis melo] Length = 300 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = -2 Query: 238 LYSVNMTLARIISLNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKE 68 L N T + + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F SKE Sbjct: 174 LVLTNFTTRLGLRVGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHR-YIFESKE 229 >ref|XP_008443155.1| PREDICTED: ribosome production factor 1 isoform X1 [Cucumis melo] gi|659084943|ref|XP_008443156.1| PREDICTED: ribosome production factor 1 isoform X1 [Cucumis melo] Length = 332 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = -2 Query: 238 LYSVNMTLARIISLNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKE 68 L N T + + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F SKE Sbjct: 206 LVLTNFTTRLGLRVGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHR-YIFESKE 261 >ref|XP_002515122.1| U3 small nucleolar ribonucleoprotein protein imp4, putative [Ricinus communis] gi|223545602|gb|EEF47106.1| U3 small nucleolar ribonucleoprotein protein imp4, putative [Ricinus communis] Length = 362 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKEC 65 + RL+QS+FPQDPN RG VV FHNQ DF+FF H R F +KEC Sbjct: 252 IGRLIQSIFPQDPNFRGRRVVTFHNQRDFIFFRHHR-YIFETKEC 295 >ref|XP_011652142.1| PREDICTED: ribosome production factor 1 [Cucumis sativus] gi|700204233|gb|KGN59366.1| hypothetical protein Csa_3G814330 [Cucumis sativus] Length = 332 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = -2 Query: 238 LYSVNMTLARIISLNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKE 68 L N T + + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F SKE Sbjct: 206 LVLTNFTTRLGLRVGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHR-YIFESKE 261 >gb|KDO86670.1| hypothetical protein CISIN_1g016414mg [Citrus sinensis] Length = 390 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = -2 Query: 259 HPLGYIFLYSVNMTLARI-ISLNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 +P G+I +N R+ + RL+QSLFPQ P RG VV FHNQ DF+FF H RC Sbjct: 224 NPTGHIPELVLNNFATRLGHRVGRLIQSLFPQSPEFRGRRVVTFHNQRDFIFFRHHRCVP 283 Query: 82 FSSKECVLFHMFTCNYI 32 C ++ + C+Y+ Sbjct: 284 LEFISCYMWTIL-CSYL 299 >emb|CDP06320.1| unnamed protein product [Coffea canephora] Length = 359 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DFVFF H R F Sbjct: 247 IGRLIQSLFPQDPNFRGRRVVTFHNQRDFVFFRHHRYIF 285 >emb|CDP18631.1| unnamed protein product [Coffea canephora] Length = 509 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DFVFF H R F Sbjct: 397 IGRLIQSLFPQDPNFRGRRVVTFHNQRDFVFFRHHRYIF 435 >ref|XP_007051371.1| Ribosomal RNA processing Brix domain protein isoform 3, partial [Theobroma cacao] gi|508703632|gb|EOX95528.1| Ribosomal RNA processing Brix domain protein isoform 3, partial [Theobroma cacao] Length = 274 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 161 IGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYVF 199 >ref|XP_007051370.1| Ribosomal RNA processing Brix domain protein isoform 2 [Theobroma cacao] gi|508703631|gb|EOX95527.1| Ribosomal RNA processing Brix domain protein isoform 2 [Theobroma cacao] Length = 326 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 213 IGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYVF 251 >ref|XP_007051369.1| Ribosomal RNA processing Brix domain protein isoform 1 [Theobroma cacao] gi|508703630|gb|EOX95526.1| Ribosomal RNA processing Brix domain protein isoform 1 [Theobroma cacao] Length = 354 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 241 IGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYVF 279 >ref|XP_009414941.1| PREDICTED: ribosome production factor 1-like [Musa acuminata subsp. malaccensis] Length = 348 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKE 68 + R++QSLFPQDPN RG VV FHNQ DF+FF H R F SKE Sbjct: 239 VGRMIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHR-YIFESKE 281 >gb|EPS61568.1| hypothetical protein M569_13224 [Genlisea aurea] Length = 313 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 ++RL+QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 210 VSRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIF 248 >ref|XP_011077098.1| PREDICTED: ribosome production factor 1 [Sesamum indicum] Length = 328 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 217 VGRLIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIF 255 >ref|XP_010940990.1| PREDICTED: ribosome production factor 1 isoform X2 [Elaeis guineensis] Length = 326 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKECV 62 + R++QSLFPQDPN RG VV FHNQ DF+FF H R F + ++ V Sbjct: 244 IGRMIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIFETKEKKV 289 >ref|XP_010940989.1| PREDICTED: ribosome production factor 1 isoform X1 [Elaeis guineensis] Length = 357 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKECV 62 + R++QSLFPQDPN RG VV FHNQ DF+FF H R F + ++ V Sbjct: 244 IGRMIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIFETKEKKV 289 >ref|XP_010054928.1| PREDICTED: ribosome production factor 1 [Eucalyptus grandis] gi|629125501|gb|KCW89926.1| hypothetical protein EUGRSUZ_A02139 [Eucalyptus grandis] Length = 365 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAFFSSKE 68 + RL+QSLFPQ+PN RG VV FHNQ DF+FF H R F SKE Sbjct: 252 VGRLIQSLFPQEPNFRGRRVVTFHNQRDFIFFRHHR-YIFDSKE 294 >ref|XP_010542822.1| PREDICTED: ribosome production factor 1-like [Tarenaya hassleriana] Length = 359 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + R++QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 245 VGRMIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIF 283 >ref|XP_004307320.1| PREDICTED: ribosome production factor 1 [Fragaria vesca subsp. vesca] Length = 352 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQ+PN RG VV FHNQ DFVFF H R F Sbjct: 239 IGRLIQSLFPQEPNFRGRRVVTFHNQRDFVFFRHHRYIF 277 >ref|XP_010242770.1| PREDICTED: ribosome production factor 1-like [Nelumbo nucifera] Length = 352 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + R +QSLFPQDPN RG VV FHNQ DF+FF H R F Sbjct: 239 IGRFIQSLFPQDPNFRGRRVVTFHNQRDFIFFRHHRYIF 277 >ref|XP_009376048.1| PREDICTED: ribosome production factor 1-like [Pyrus x bretschneideri] Length = 349 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 199 LNRLMQSLFPQDPNIRGL*VVMFHNQHDFVFFCHQRCAF 83 + RL+QSLFPQ+PN RG VV FHNQ DF+FF H R F Sbjct: 237 IGRLIQSLFPQEPNFRGRRVVTFHNQRDFIFFRHHRYIF 275