BLASTX nr result
ID: Gardenia21_contig00017794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017794 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239102.2| PREDICTED: protein UXT homolog [Solanum lyco... 88 2e-15 emb|CDP00380.1| unnamed protein product [Coffea canephora] 87 4e-15 ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499... 86 1e-14 ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycin... 86 1e-14 ref|XP_011623583.1| PREDICTED: protein UXT homolog [Amborella tr... 85 2e-14 ref|XP_008462175.1| PREDICTED: protein UXT homolog [Cucumis melo] 85 2e-14 gb|ERN06505.1| hypothetical protein AMTR_s00058p00071840 [Ambore... 85 2e-14 ref|XP_012448248.1| PREDICTED: protein UXT homolog isoform X2 [G... 85 2e-14 ref|XP_012448245.1| PREDICTED: protein UXT homolog isoform X1 [G... 85 2e-14 ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sati... 85 2e-14 gb|KRH70811.1| hypothetical protein GLYMA_02G111700 [Glycine max] 84 4e-14 gb|KHN01992.1| Protein UXT like [Glycine soja] 84 4e-14 ref|XP_006574924.1| PREDICTED: protein UXT homolog isoform X2 [G... 84 4e-14 ref|XP_006574923.1| PREDICTED: protein UXT homolog isoform X1 [G... 84 4e-14 ref|XP_009795700.1| PREDICTED: protein UXT homolog [Nicotiana sy... 84 5e-14 ref|XP_009624242.1| PREDICTED: protein UXT homolog [Nicotiana to... 84 5e-14 ref|XP_006348738.1| PREDICTED: protein UXT homolog [Solanum tube... 83 7e-14 ref|XP_014492934.1| PREDICTED: protein UXT homolog [Vigna radiat... 83 9e-14 ref|XP_011081895.1| PREDICTED: protein UXT homolog isoform X1 [S... 82 1e-13 gb|KOM45915.1| hypothetical protein LR48_Vigan06g122100 [Vigna a... 82 2e-13 >ref|XP_004239102.2| PREDICTED: protein UXT homolog [Solanum lycopersicum] Length = 184 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 158 RSKMDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 R MD ++QEK++R+EEF+D RLKPDLVHAIAERDKVFEQQK+FSDL+RNIE Sbjct: 36 RIAMDTIKQEKVRRFEEFIDRRLKPDLVHAIAERDKVFEQQKIFSDLRRNIE 87 >emb|CDP00380.1| unnamed protein product [Coffea canephora] Length = 146 Score = 87.4 bits (215), Expect = 4e-15 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 2/51 (3%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAER--DKVFEQQKVFSDLKRNIE 3 MD VRQEKIQR+EEFVD RLKPDLVHAIAER DKVFEQQKVFSDLKRNIE Sbjct: 1 MDRVRQEKIQRFEEFVDRRLKPDLVHAIAERHLDKVFEQQKVFSDLKRNIE 51 >ref|XP_006572821.1| PREDICTED: uncharacterized protein LOC100499907 isoform X2 [Glycine max] Length = 136 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL++NIE Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFTDLRKNIE 49 >ref|NP_001237769.1| uncharacterized protein LOC100499907 [Glycine max] gi|571433258|ref|XP_006572820.1| PREDICTED: uncharacterized protein LOC100499907 isoform X1 [Glycine max] gi|255627579|gb|ACU14134.1| unknown [Glycine max] gi|734421725|gb|KHN41370.1| Protein UXT like [Glycine soja] gi|947127088|gb|KRH74942.1| hypothetical protein GLYMA_01G053200 [Glycine max] Length = 151 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL++NIE Sbjct: 1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFTDLRKNIE 49 >ref|XP_011623583.1| PREDICTED: protein UXT homolog [Amborella trichopoda] Length = 142 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD VR+EK+ ++EEFVD RLKPDLVHAIAERDKVF QQKVFSDLKRNIE Sbjct: 1 MDSVRKEKVHKFEEFVDRRLKPDLVHAIAERDKVFAQQKVFSDLKRNIE 49 >ref|XP_008462175.1| PREDICTED: protein UXT homolog [Cucumis melo] Length = 155 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 146 DWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 D R EK+QR+EEFVD RLKPDLVHAIAERDKVFEQQKVFSDL+RNIE Sbjct: 6 DSFRNEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKVFSDLRRNIE 53 >gb|ERN06505.1| hypothetical protein AMTR_s00058p00071840 [Amborella trichopoda] Length = 152 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD VR+EK+ ++EEFVD RLKPDLVHAIAERDKVF QQKVFSDLKRNIE Sbjct: 11 MDSVRKEKVHKFEEFVDRRLKPDLVHAIAERDKVFAQQKVFSDLKRNIE 59 >ref|XP_012448248.1| PREDICTED: protein UXT homolog isoform X2 [Gossypium raimondii] Length = 137 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEKIQ++EEFVD RLKPD+VHAIAERDK+F+QQK+FSDL++NIE Sbjct: 1 MDSLRQEKIQKFEEFVDRRLKPDVVHAIAERDKIFDQQKIFSDLRKNIE 49 >ref|XP_012448245.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|823231072|ref|XP_012448246.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|823231074|ref|XP_012448247.1| PREDICTED: protein UXT homolog isoform X1 [Gossypium raimondii] gi|763793785|gb|KJB60781.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793787|gb|KJB60783.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793788|gb|KJB60784.1| hypothetical protein B456_009G325600 [Gossypium raimondii] gi|763793789|gb|KJB60785.1| hypothetical protein B456_009G325600 [Gossypium raimondii] Length = 151 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEKIQ++EEFVD RLKPD+VHAIAERDK+F+QQK+FSDL++NIE Sbjct: 1 MDSLRQEKIQKFEEFVDRRLKPDVVHAIAERDKIFDQQKIFSDLRKNIE 49 >ref|XP_004141760.1| PREDICTED: protein UXT homolog [Cucumis sativus] gi|700190160|gb|KGN45393.1| hypothetical protein Csa_7G447080 [Cucumis sativus] Length = 155 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 146 DWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 D R EK+QR+EEFVD RLKPDLVHAIAERDKVFEQQKVFSDL+RNIE Sbjct: 6 DNFRHEKVQRFEEFVDRRLKPDLVHAIAERDKVFEQQKVFSDLRRNIE 53 >gb|KRH70811.1| hypothetical protein GLYMA_02G111700 [Glycine max] Length = 128 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL +NIE Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIE 49 >gb|KHN01992.1| Protein UXT like [Glycine soja] Length = 228 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL +NIE Sbjct: 78 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIE 126 >ref|XP_006574924.1| PREDICTED: protein UXT homolog isoform X2 [Glycine max] gi|947122603|gb|KRH70809.1| hypothetical protein GLYMA_02G111700 [Glycine max] gi|947122604|gb|KRH70810.1| hypothetical protein GLYMA_02G111700 [Glycine max] Length = 151 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL +NIE Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIE 49 >ref|XP_006574923.1| PREDICTED: protein UXT homolog isoform X1 [Glycine max] Length = 161 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +RQEK+QR+EEFVD RLKPDLVHAIA+RDKVFEQQK+F+DL +NIE Sbjct: 1 MDNLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFADLGKNIE 49 >ref|XP_009795700.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] gi|698499812|ref|XP_009795702.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] gi|698499814|ref|XP_009795703.1| PREDICTED: protein UXT homolog [Nicotiana sylvestris] Length = 146 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD ++ EK++R+EEFVD RLKPDLVHAIAERDKVFEQQK+FSDL+ NIE Sbjct: 1 MDTIKHEKVRRFEEFVDRRLKPDLVHAIAERDKVFEQQKIFSDLRSNIE 49 >ref|XP_009624242.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140293|ref|XP_009624243.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140295|ref|XP_009624244.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] gi|697140297|ref|XP_009624245.1| PREDICTED: protein UXT homolog [Nicotiana tomentosiformis] Length = 146 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD ++ EK++R+EEFVD RLKPDLVHAIAERDKVFEQQK+FSDL+ NIE Sbjct: 1 MDTIKHEKVRRFEEFVDRRLKPDLVHAIAERDKVFEQQKIFSDLRSNIE 49 >ref|XP_006348738.1| PREDICTED: protein UXT homolog [Solanum tuberosum] Length = 146 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 M+ ++QEK++R+EEF+D RLKPDLVHAIAERDKVFEQQK+FSDL+ NIE Sbjct: 1 MNTIKQEKVRRFEEFIDRRLKPDLVHAIAERDKVFEQQKIFSDLRSNIE 49 >ref|XP_014492934.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] gi|951075512|ref|XP_014492935.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] gi|951075515|ref|XP_014492936.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] gi|951075518|ref|XP_014492937.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] gi|951075521|ref|XP_014492938.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] gi|951075523|ref|XP_014492939.1| PREDICTED: protein UXT homolog [Vigna radiata var. radiata] Length = 152 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -2 Query: 146 DWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 D RQEK+++YEEFVD RLKPDL+HAI++RDKVFEQQK+FSDL+RNIE Sbjct: 3 DNARQEKVRKYEEFVDKRLKPDLIHAISQRDKVFEQQKIFSDLRRNIE 50 >ref|XP_011081895.1| PREDICTED: protein UXT homolog isoform X1 [Sesamum indicum] Length = 145 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -2 Query: 149 MDWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 MD +Q KI+++EEFVD RLKPDLVHAIA+RDKVFEQQK+FSDL+RNIE Sbjct: 1 MDSAKQNKIRKFEEFVDRRLKPDLVHAIAQRDKVFEQQKIFSDLRRNIE 49 >gb|KOM45915.1| hypothetical protein LR48_Vigan06g122100 [Vigna angularis] Length = 152 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/48 (75%), Positives = 45/48 (93%) Frame = -2 Query: 146 DWVRQEKIQRYEEFVDGRLKPDLVHAIAERDKVFEQQKVFSDLKRNIE 3 D RQEK+++YEEFVD RLKPDL+HAI++RDKVFEQQK+F+DL+RNIE Sbjct: 3 DSARQEKVRKYEEFVDKRLKPDLIHAISQRDKVFEQQKIFADLRRNIE 50