BLASTX nr result
ID: Gardenia21_contig00017771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017771 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14194.1| unnamed protein product [Coffea canephora] 58 3e-06 >emb|CDP14194.1| unnamed protein product [Coffea canephora] Length = 648 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 114 KPHVKQALPGILLFHLEDQLIPCNLTWKVPCFP 16 +P+VKQ LPG+LLF L++QL P NL WKVPCFP Sbjct: 9 RPYVKQELPGVLLFRLKEQLFPYNLNWKVPCFP 41