BLASTX nr result
ID: Gardenia21_contig00017692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017692 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11712.1| unnamed protein product [Coffea canephora] 74 6e-11 >emb|CDP11712.1| unnamed protein product [Coffea canephora] Length = 74 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 129 CSPSVHSAAAGVHRRAQGKHGRQQRRPQFNHGSFRG 22 CS S HSAAAGVHRRAQGKHGRQQ+RP+FNHGSFRG Sbjct: 18 CSSSAHSAAAGVHRRAQGKHGRQQKRPRFNHGSFRG 53