BLASTX nr result
ID: Gardenia21_contig00017641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017641 (271 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01139.1| unnamed protein product [Coffea canephora] 83 7e-14 ref|XP_010645811.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 79 1e-12 ref|XP_010645812.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 74 3e-11 emb|CBI29343.3| unnamed protein product [Vitis vinifera] 74 3e-11 ref|XP_010320120.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 73 7e-11 ref|XP_006359054.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 73 7e-11 ref|XP_004237844.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 73 7e-11 ref|XP_008381069.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 72 2e-10 gb|ERM94374.1| hypothetical protein AMTR_s00010p00250130 [Ambore... 71 3e-10 gb|KMZ65669.1| tRNA pseudouridine(38/39) synthase [Zostera marina] 71 4e-10 ref|XP_011074124.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 5e-10 ref|XP_011074123.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 5e-10 ref|XP_011074122.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 5e-10 ref|XP_010062063.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 6e-10 ref|XP_010062062.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 6e-10 ref|XP_009769567.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 8e-10 ref|XP_009604973.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 70 8e-10 gb|KRG91735.1| hypothetical protein GLYMA_20G171700 [Glycine max] 69 1e-09 gb|KHN03704.1| tRNA pseudouridine(38/39) synthase [Glycine soja] 69 1e-09 ref|XP_006606191.1| PREDICTED: tRNA pseudouridine(38/39) synthas... 69 1e-09 >emb|CDP01139.1| unnamed protein product [Coffea canephora] Length = 443 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSG 125 IDLLLDTEKTTRKPQYTMA+EIPLVLQSCEFEGL+FICSSG Sbjct: 326 IDLLLDTEKTTRKPQYTMAAEIPLVLQSCEFEGLRFICSSG 366 >ref|XP_010645811.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X1 [Vitis vinifera] Length = 454 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTL 131 +D LLDTE+T+RKPQY MA EIPLVL+SCEFEGLKFICSSGTL Sbjct: 332 VDALLDTERTSRKPQYAMAPEIPLVLESCEFEGLKFICSSGTL 374 >ref|XP_010645812.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X2 [Vitis vinifera] Length = 449 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTLGLLVLLFD----TYAAR 170 +D LLDTE+T+RKPQY MA EIPLVL+SCEFEGLKFICSS L + + TY + Sbjct: 332 VDALLDTERTSRKPQYAMAPEIPLVLESCEFEGLKFICSSDAGQALRMHLENECRTYQLQ 391 Query: 171 AGILYAGL 194 A I + L Sbjct: 392 AAIFHEAL 399 >emb|CBI29343.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTLGLLVLLFD----TYAAR 170 +D LLDTE+T+RKPQY MA EIPLVL+SCEFEGLKFICSS L + + TY + Sbjct: 349 VDALLDTERTSRKPQYAMAPEIPLVLESCEFEGLKFICSSDAGQALRMHLENECRTYQLQ 408 Query: 171 AGILYAGL 194 A I + L Sbjct: 409 AAIFHEAL 416 >ref|XP_010320120.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X2 [Solanum lycopersicum] gi|723694039|ref|XP_010320121.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X2 [Solanum lycopersicum] Length = 349 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGT 128 IDLLLD E+T RKPQ+ MA EIPLVLQSCEFEGLKFICSS T Sbjct: 237 IDLLLDIERTPRKPQFPMAPEIPLVLQSCEFEGLKFICSSDT 278 >ref|XP_006359054.1| PREDICTED: tRNA pseudouridine(38/39) synthase-like [Solanum tuberosum] Length = 481 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGT 128 IDLLLD E+T RKPQ+ MA EIPLVLQSCEFEGLKFICSS T Sbjct: 369 IDLLLDIERTPRKPQFPMAPEIPLVLQSCEFEGLKFICSSDT 410 >ref|XP_004237844.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X1 [Solanum lycopersicum] Length = 420 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGT 128 IDLLLD E+T RKPQ+ MA EIPLVLQSCEFEGLKFICSS T Sbjct: 308 IDLLLDIERTPRKPQFPMAPEIPLVLQSCEFEGLKFICSSDT 349 >ref|XP_008381069.1| PREDICTED: tRNA pseudouridine(38/39) synthase [Malus domestica] Length = 455 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 +D LLDT +T RKPQYTMA EIPLVLQSCEFEGLKF CSS Sbjct: 341 VDALLDTSRTPRKPQYTMAPEIPLVLQSCEFEGLKFTCSS 380 >gb|ERM94374.1| hypothetical protein AMTR_s00010p00250130 [Amborella trichopoda] Length = 446 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTL 131 ID LLDT KTTRKPQYTMA E+PLVL+SCEFE + F+CSSG L Sbjct: 393 IDALLDTTKTTRKPQYTMAPELPLVLRSCEFEAVDFMCSSGIL 435 >gb|KMZ65669.1| tRNA pseudouridine(38/39) synthase [Zostera marina] Length = 474 Score = 70.9 bits (172), Expect = 4e-10 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTLGLLV----LLFDTYAAR 170 IDLLLDT K TRKPQYTMAS++PLVL+SCEF+G+ F CSS L+ + ++ + Sbjct: 358 IDLLLDTSKITRKPQYTMASDVPLVLRSCEFKGINFFCSSAARRALMDDLNDIVKSHKLQ 417 Query: 171 AGILYAGLGFLH 206 A I L LH Sbjct: 418 AAIFNEALTLLH 429 >ref|XP_011074124.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X3 [Sesamum indicum] Length = 383 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID LLD E+T RKPQYTMA EIPLVLQSCEFEGLKF CSS Sbjct: 266 IDELLDVERTPRKPQYTMAPEIPLVLQSCEFEGLKFRCSS 305 >ref|XP_011074123.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X2 [Sesamum indicum] Length = 407 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID LLD E+T RKPQYTMA EIPLVLQSCEFEGLKF CSS Sbjct: 290 IDELLDVERTPRKPQYTMAPEIPLVLQSCEFEGLKFRCSS 329 >ref|XP_011074122.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X1 [Sesamum indicum] Length = 448 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID LLD E+T RKPQYTMA EIPLVLQSCEFEGLKF CSS Sbjct: 331 IDELLDVERTPRKPQYTMAPEIPLVLQSCEFEGLKFRCSS 370 >ref|XP_010062063.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X2 [Eucalyptus grandis] Length = 446 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 4/68 (5%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTLGLLVLLFD----TYAAR 170 +D LLDT+ T RKPQYTMA E+PLVLQSCEFEG++FICSS L + + TY Sbjct: 322 MDALLDTDGTPRKPQYTMAPEMPLVLQSCEFEGVRFICSSDARQALHVHLEDGYRTYELE 381 Query: 171 AGILYAGL 194 A + Y L Sbjct: 382 AAMAYEAL 389 >ref|XP_010062062.1| PREDICTED: tRNA pseudouridine(38/39) synthase isoform X1 [Eucalyptus grandis] gi|629103665|gb|KCW69134.1| hypothetical protein EUGRSUZ_F02671 [Eucalyptus grandis] Length = 449 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 4/68 (5%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSSGTLGLLVLLFD----TYAAR 170 +D LLDT+ T RKPQYTMA E+PLVLQSCEFEG++FICSS L + + TY Sbjct: 322 MDALLDTDGTPRKPQYTMAPEMPLVLQSCEFEGVRFICSSDARQALHVHLEDGYRTYELE 381 Query: 171 AGILYAGL 194 A + Y L Sbjct: 382 AAMAYEAL 389 >ref|XP_009769567.1| PREDICTED: tRNA pseudouridine(38/39) synthase [Nicotiana sylvestris] Length = 428 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID LLD E+T RKPQ+ MA EIPLVLQSCEFEGLKFICSS Sbjct: 310 IDALLDIERTPRKPQFLMAPEIPLVLQSCEFEGLKFICSS 349 >ref|XP_009604973.1| PREDICTED: tRNA pseudouridine(38/39) synthase [Nicotiana tomentosiformis] Length = 427 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID LLD E+T RKPQ+ MA EIPLVLQSCEFEGLKFICSS Sbjct: 310 IDALLDIERTPRKPQFLMAPEIPLVLQSCEFEGLKFICSS 349 >gb|KRG91735.1| hypothetical protein GLYMA_20G171700 [Glycine max] Length = 351 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID+LLDT + RKPQYTMASE+PLVLQSCEF+ +KF+CSS Sbjct: 237 IDMLLDTSRILRKPQYTMASEVPLVLQSCEFDNIKFMCSS 276 >gb|KHN03704.1| tRNA pseudouridine(38/39) synthase [Glycine soja] Length = 426 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID+LLDT + RKPQYTMASE+PLVLQSCEF+ +KF+CSS Sbjct: 312 IDMLLDTSRILRKPQYTMASEVPLVLQSCEFDNIKFMCSS 351 >ref|XP_006606191.1| PREDICTED: tRNA pseudouridine(38/39) synthase-like isoform X2 [Glycine max] Length = 425 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 3 IDLLLDTEKTTRKPQYTMASEIPLVLQSCEFEGLKFICSS 122 ID+LLDT + RKPQYTMASE+PLVLQSCEF+ +KF+CSS Sbjct: 311 IDMLLDTSRILRKPQYTMASEVPLVLQSCEFDNIKFMCSS 350