BLASTX nr result
ID: Gardenia21_contig00017616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017616 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06608.1| unnamed protein product [Coffea canephora] 111 2e-22 ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplast... 63 1e-07 >emb|CDP06608.1| unnamed protein product [Coffea canephora] Length = 413 Score = 111 bits (277), Expect = 2e-22 Identities = 52/57 (91%), Positives = 53/57 (92%) Frame = -1 Query: 386 TLEQLQDSKGTSNHDQKDSQLNLHGNPGGGPRYCRRSAEEAPGMTAYPRPSGSPLYA 216 TLEQLQD KGTSNHDQKDSQLNL GN GGGPR+CRRSAEEAPGMTAYPRPS SPLYA Sbjct: 357 TLEQLQDLKGTSNHDQKDSQLNLDGNSGGGPRHCRRSAEEAPGMTAYPRPSASPLYA 413 >ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum] Length = 414 Score = 62.8 bits (151), Expect = 1e-07 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 383 LEQLQDSKGTS-NHDQKDSQLNLHGNPGGGPRYCRRSAEEAPGMTAYPRPSGSPLYA 216 LEQLQ+SK T+ +DQKD +LN H GGP+ CR S EE +AYPRPS S LYA Sbjct: 359 LEQLQESKDTTLKNDQKDHRLNRHSQSNGGPKSCRSSTEETQAASAYPRPSAS-LYA 414